KEGG   Bordetella bronchiseptica RB50: BB1839Help
Entry
BB1839            CDS       T00141                                 

Definition
(GenBank) putative cytochrome c
  KO
K08738  cytochrome c
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
bbr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bbr00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BB1839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: CAE32336
GeneDB: BB1839
UniProt: A0A0H3LKR3
Position
1943595..1944005
Genome map
AA seq 136 aa AA seqDB search
MNAGLAWRAGALCLALAAPAAARAAAPDPVRGEQVYARCLACHALAYDRVGPRHCGLLGR
KAGSVPGFAYTQAMKDSGLTWDAATLDRFLADPLKTVPGTAMTYAGVPDAGERADLIAYL
RAAAASPACAGVATPH
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgggcctggcctggcgggccggcgcgctgtgcctggccctggccgcgccggcg
gccgcgcgggccgcagcgcccgacccggtgcgcggcgagcaggtctacgcgcgctgcctg
gcctgccacgcgctggcctacgaccgggtggggccgcgccactgcggcctgctcgggcgc
aaggccggcagcgtgcccggcttcgcctatacgcaagccatgaaagactccggcctgacc
tgggacgccgccacgctcgaccgcttcctggccgatcccttgaagacggtgccaggcacc
gccatgacttacgcgggcgtgccggatgcgggcgagcgcgccgacctcatcgcctacttg
cgcgcggccgccgcctcgccggcgtgcgcgggcgtggccacgccgcattag

DBGET integrated database retrieval system