KEGG   Bordetella bronchiseptica RB50: BB1861Help
Entry
BB1861            CDS       T00141                                 

Definition
(GenBank) putative acyl-CoA transferase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
bbr00020  Citrate cycle (TCA cycle)
bbr00620  Pyruvate metabolism
bbr00650  Butanoate metabolism
bbr01100  Metabolic pathways
bbr01110  Biosynthesis of secondary metabolites
bbr01120  Microbial metabolism in diverse environments
bbr01130  Biosynthesis of antibiotics
bbr01200  Carbon metabolism
Module
bbr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bbr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BB1861
   00620 Pyruvate metabolism
    BB1861
   00650 Butanoate metabolism
    BB1861
Enzymes [BR:bbr01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     BB1861
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CitF CoA_trans
Motif
Other DBs
NCBI-ProteinID: CAE32358
GeneDB: BB1861
UniProt: A0A0H3LR22
Position
1967973..1969490
Genome map
AA seq 505 aa AA seqDB search
MHLERIRHPGLRARLASPQEAARLVHDGMTVGMSGFTRAGDCKSVPAALAERAAAEPLRI
TLLTGASLGHDTDKLLAQAGVLARRMPFQVDTTLRRKINQGEIAFVDQHLSETVEQLRAG
HIGPIDIAIVEAAAITEDGGIVPTMSVGNSASFVEQARLVIVELNLGVPAAIEGLHDIVI
PGARPGRQPLPLVSVDQRIGAPCIAVDPDKIAAIVVTNEPDSPSNALPPDEETGAIAGHI
VGFLRQEVNQGRLSRSLLPLQAGIGTIANAVLHGFGESEFEGLTMYSEVLQDSAIELLDQ
GKLSFASASSITVSLPVYERILGNLEHYRQRIVLRPQEISNAPELVRRLGVIAINTALEF
DIYGNVNSTHVGGTHMMNGIGGSGDFARNAHLSIFVTKSMARNGDISSVVPMVSHVDHNE
HDVDILVTECGLADLRGLAPRERARAIIAHCVHPSYRDALRDYFERACRRGGQTPHLLEE
AFSWHQRYNETDTMRLAAPAARRVA
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgcatctcgaacgtattcgccatcccggcctgcgcgcccggttggcttccccccaggaa
gcggcccggctggtccacgacggcatgaccgtcggcatgagcgggttcacgcgcgcgggc
gactgcaaatcggtgccggcggcgctggccgaaagagccgccgccgagccgctgcgcatc
acgctgctgaccggcgcctcgctggggcatgacaccgacaagctgctggcgcaggccggc
gttctggcgcgccgcatgccgttccaggtcgacaccacgctgcggcgcaagatcaaccag
ggcgagatcgcctttgtcgaccagcacttgtccgaaaccgtcgagcagttgcgcgccggc
catatcggccccatcgacatcgccatcgtcgaggcggctgccatcaccgaagacggcggc
atcgtgccgaccatgtcggtcggcaactcggcctcgttcgtcgagcaggcccgcctggtc
atcgtcgagctcaatctcggcgtgcccgcggccatcgaaggcctgcacgacatcgtgatc
ccgggcgcgcggcccggccgccagcccctgccgctggtgtcggtcgaccagcgcatcggc
gcgccctgcatcgcggtggaccccgacaagatcgccgccatcgtcgtcaccaacgaaccg
gacagtccctcaaacgccttgccgcccgacgaggagaccggcgccatcgccggccacatc
gtcggcttcctgcgccaggaagtgaaccaggggcgcctgagccgctcgctgctgcccctg
caggccggcatcggcacgatcgccaatgccgtgctgcacgggttcggcgagtcggaattc
gaggggctcaccatgtattcggaagtgctgcaggacagcgcgatcgaactcctggaccag
ggcaagctgagtttcgcctcggcctcgtccatcacggtctcgctgccggtgtacgaacgc
atcctgggcaacctcgagcactaccgccagcgcatcgtgctgcgcccgcaggaaatcagc
aacgcgcccgagctggtgcgccgcctgggcgtgatcgccatcaacacggcgctggagttc
gacatctacggcaacgtcaactccacccatgtgggcggcacccatatgatgaacggcatc
ggcggttcgggggactttgcgcgcaacgcgcacctgtccatcttcgtgaccaagtccatg
gccaggaacggcgatatttccagcgtggtgcccatggtctcgcatgtggaccacaacgag
cacgacgtcgatatcctggtgaccgagtgcgggctggcggacctgcgcggcctggcgccg
cgcgagcgcgctcgcgccatcatcgcccattgcgtgcatccctcgtaccgcgatgcgctg
cgcgattacttcgagcgcgcctgcaggcgcggcgggcaaacgccccatctgctggaggag
gccttctcctggcaccagcgctacaacgaaaccgacacgatgcggctggcggcgccggcg
gcccggcgcgtggcctga

DBGET integrated database retrieval system