KEGG   Bordetella bronchiseptica RB50: BB3200Help
Entry
BB3200            CDS       T00141                                 

Definition
(GenBank) putative amidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
bbr00330  Arginine and proline metabolism
bbr00360  Phenylalanine metabolism
bbr00380  Tryptophan metabolism
bbr00627  Aminobenzoate degradation
bbr00643  Styrene degradation
bbr01100  Metabolic pathways
bbr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bbr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    BB3200
   00360 Phenylalanine metabolism
    BB3200
   00380 Tryptophan metabolism
    BB3200
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BB3200
   00643 Styrene degradation
    BB3200
Enzymes [BR:bbr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     BB3200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: CAE33692
GeneDB: BB3200
UniProt: A0A0H3LP53
Position
complement(3415165..3416520)
Genome map
AA seq 451 aa AA seqDB search
MTSTDQHIARAGVAELARGIARGAFTPAEVTDVFLRRIQDLNPAIGAFVAVYEDEARHAA
RQATQALAQGQRLSPLHGIPFAVKDIVDVAGRFTTYGSRTGAGRQAGATAEYVRALLDAG
MILLGKTHTVEFAFGGWGTNQRMGTPRNPLRADVPCATGGSSSGSGAAVGAQMVPFAVGT
DTGGSIRIPSAFCGLTGMRPSMGRHSGAGVMSLSHTLDTIGPLARTVEDVQMLDDLLTGK
TATDTAQPGSQAVARVRDARIGVLGAQWLGAIEPEVAHAYAQSLRAFEAMGATLVELALP
FDREAFAQLTSTLIACEGLQFAGKYVHDPLSGMDEDVRARFLVGDRYDAAAYAELLGRRS
AMIDTFTQAMAGVKALLMPTTPCVAQPLAGLEQSPYNPAVYTRMPAWLGCCALAVPNGSG
AHGLPTSLQIVGLPESDRLVMSLGRAYQEYA
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgaccagtactgaccagcatattgcccgggccggcgtcgccgagctcgccagggggatc
gcccggggcgcgttcacgcccgccgaggtgaccgacgtcttcctgcgccgcatccaggac
ctgaatcccgcgatcggggcgttcgtggccgtctacgaggacgaggcccggcacgcggcc
cgccaggccacgcaggcgctggcgcaagggcagcgcctgagccccttgcatggcattccg
ttcgccgtgaaggacatcgtcgacgtggccggcagattcacgacctatggctcgcgcacc
ggcgcggggcggcaggccggcgccaccgccgagtacgtgcgtgcgctgctcgatgccggg
atgatcctgctgggcaagacgcacaccgtggaattcgcgttcggcggctggggcaccaac
cagcgcatgggaacgccgcgcaatccgctgcgcgcggacgtgccctgcgcgacgggcgga
tcgagcagcggatcgggggccgccgtcggcgcgcagatggtgcccttcgcggtaggcacg
gacaccggcggctcgatccgcattccttcggcgttctgcgggctgaccggcatgcggccc
agcatggggcgccacagcggcgcgggcgtcatgtcgctcagccacaccctggacaccatc
ggaccgttggcgcgcaccgtcgaagacgtgcagatgctcgacgacctgttgaccggcaag
accgccacggacaccgcgcagccgggttcgcaggccgtggcgcgcgtgcgcgacgcgcgt
atcggcgtgctcggcgcgcaatggctgggcgccatcgagcccgaggtggcgcacgcctat
gcgcaaagcctgcgggccttcgaggcgatgggcgcgacgctggtcgagctggcgctgccg
ttcgaccgggaagcgttcgcccagttgacctccacgctgatcgcctgcgaaggcctgcaa
ttcgccgggaagtacgtccacgacccactgtccggcatggacgaggacgtgcgcgcgcgc
ttcctggtgggcgaccggtacgatgccgccgcctatgccgaattgctggggcgccgcagc
gcgatgatcgatacgttcacgcaggcgatggccggcgtcaaggccttgctgatgcctacg
acgccgtgcgtggcgcagccgcttgcggggctggagcagtcgccgtacaacccggcggtg
tacacgcgcatgccggcgtggctcggctgctgcgcgctggcggtgcccaacggctcgggg
gcgcacggcttgccgacctccctgcagatcgtcggcctgcccgaatcggaccggctggtg
atgtcgctggggcgagcctatcaggaatatgcgtag

DBGET integrated database retrieval system