KEGG   Bordetella bronchiseptica RB50: BB3364Help
Entry
BB3364            CDS       T00141                                 

Definition
(GenBank) putative thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
bbr00071  Fatty acid degradation
bbr00072  Synthesis and degradation of ketone bodies
bbr00280  Valine, leucine and isoleucine degradation
bbr00310  Lysine degradation
bbr00362  Benzoate degradation
bbr00380  Tryptophan metabolism
bbr00620  Pyruvate metabolism
bbr00630  Glyoxylate and dicarboxylate metabolism
bbr00640  Propanoate metabolism
bbr00650  Butanoate metabolism
bbr00900  Terpenoid backbone biosynthesis
bbr01100  Metabolic pathways
bbr01110  Biosynthesis of secondary metabolites
bbr01120  Microbial metabolism in diverse environments
bbr01130  Biosynthesis of antibiotics
bbr01200  Carbon metabolism
bbr01212  Fatty acid metabolism
bbr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bbr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BB3364
   00630 Glyoxylate and dicarboxylate metabolism
    BB3364
   00640 Propanoate metabolism
    BB3364
   00650 Butanoate metabolism
    BB3364
  Lipid metabolism
   00071 Fatty acid degradation
    BB3364
   00072 Synthesis and degradation of ketone bodies
    BB3364
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BB3364
   00310 Lysine degradation
    BB3364
   00380 Tryptophan metabolism
    BB3364
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BB3364
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BB3364
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BB3364
Enzymes [BR:bbr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BB3364
Exosome [BR:bbr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BB3364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: CAE33856
GeneDB: BB3364
UniProt: A0A0H3LQV5
Position
complement(3593518..3594723)
Genome map
AA seq 401 aa AA seqDB search
MKTGGIDIMNEVVVVAAARTAIGDFGGGLKDVAPCDLGATVIREALARAGVAGPEVGHVA
VGHVINTEPRDMYLSRVAAINAGIGKETPAFNVNRLCGSGLQAIVSAAQTIMLGDTEIAV
GAGAESMSRAPYIAPAQRWGARMGDSAMVDMMTGALSDPFGRMHMGVTAENVAARYSISR
ADQDALAVESHRRAAAAIDAGRFRDQIVPVTLKTRKGETVFDTDEHVRRDITIEGMAALR
PVFQKENGTVTAGNASGLNDGAGAVVLMSAAAAAQRGIAPMARLVAYAHAGVDPEIMGIG
PVPATQAALKRAGLTVDQLDVIEANEAFAAQACAVTRQLELDPAKVNPNGSGISLGHPIG
ATGAIITVKALYELQRVGGRYALVTMCIGGGQGIAAIFERV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaggaggaattgacatcatgaacgaagtcgtagtcgtagccgctgcccgtacc
gccattggcgatttcggcggcggcctgaaagatgtggcgccctgcgacctgggcgccacg
gtcatccgggaagcgctggcgcgcgccggcgtggccggccccgaggtaggccacgtcgcc
gtcggccatgtcatcaacaccgagccgcgcgacatgtacctgtcccgcgtggccgcgatc
aatgccggcatcggcaaggaaaccccggcgttcaacgtcaaccgcctgtgcgggtcgggg
ctgcaggcgatcgtgtcggccgcccagaccatcatgctgggcgataccgagatcgccgtg
ggcgcgggcgccgaaagcatgagccgcgcgccgtatatcgccccggcgcagcgctggggc
gcgcgcatgggcgacagcgccatggtcgacatgatgaccggcgcgctgtccgatccgttt
ggccgcatgcacatgggcgtgacggccgagaacgtggcggcgcgctattccatcagccgc
gccgaccaggacgcgctggcggtcgagtcgcatcgccgcgccgcggccgccatcgacgcg
ggccgctttcgcgaccagatcgtcccggtgacgttgaagacgcgcaagggcgagactgtg
ttcgacaccgatgagcacgtgcgccgcgacatcaccatcgaaggcatggcggccctgcgg
ccggtgttccagaaggaaaacggcacggtcacggcgggcaacgcgtcgggcctgaacgac
ggcgcgggggcggtggtgctgatgagcgcggccgcggcggcgcagcgcggcatcgcgccg
atggcgcgcctggtggcctatgcgcatgccggcgtggaccccgagatcatgggcatcggc
ccggtgccggccacgcaggccgcgctcaagcgcgccggcctgaccgtcgaccagctcgac
gtgatcgaggccaacgaggcgttcgccgcgcaggcctgcgcggtgacgcgccagctggag
ctggatcccgccaaggtcaatccgaacggcagcggcatcagcctgggccatcccatcggc
gcgaccggggccatcatcacggtcaaggccttgtacgagctgcagcgcgtgggcggccgc
tacgcgctggtgacgatgtgcatcggcggcgggcagggcatcgccgccattttcgagcgc
gtctga

DBGET integrated database retrieval system