KEGG   Bordetella bronchiseptica RB50: BB3810Help
Entry
BB3810            CDS       T00141                                 

Gene name
risA
Definition
(GenBank) tresponse regulator protein
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
bbr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bbr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BB3810 (risA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bbr02022]
    BB3810 (risA)
Two-component system [BR:bbr02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   BB3810 (risA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: CAE35784
GeneDB: BB3810
UniProt: A0A0R4J7G1
Position
4035881..4036615
Genome map
AA seq 244 aa AA seqDB search
MNTQNTTPTRKILVVDDDPRLRDLLRRYLSEQGFNVFVAEDAKEMGKLWQREHFDLLVLD
LMLPGEDGLSICRRLRGGHDNTPIIMLTAKAEEIDRIVGLEMGADDYLSKPFNPRELLAR
INAILRRRGTEEHPGAPSQENESIAFGPYVLNLSTRTLTRNGEQVPITTGEFSVLKVFAR
HPKIPLSRDKLMELARGREYEAFDRSLDVQISRLRKLIEPNPSKPVFIQTVWGLGYVFVP
DGGS
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgcaaaacaccactcctacccgcaagatcctggtcgtcgacgatgatccccga
ctgcgcgatctcctgcgccgctatctgtcggaacaagggttcaatgtattcgtggccgaa
gatgccaaggaaatgggcaaactgtggcaacgcgaacactttgacctgctggttctcgac
ctgatgctgccgggcgaggatggcctgtcgatctgccgccgcctgcgcggcggccacgac
aatactcccatcatcatgctgaccgccaaggccgaggaaatcgaccggatcgtcggcctg
gaaatgggagccgacgattacctgtccaagcccttcaacccgcgcgaactgctggcccgc
atcaatgcgatcctgcgccgccgcggcaccgaagagcacccgggcgcgcccagccaggaa
aacgagtcgatcgccttcggcccgtacgtcctgaacctgtccacgcgcaccctcacccgc
aatggcgagcaggtgccgatcacgaccggcgaattctcggtcctgaaggtttttgcccgc
catcccaagatcccgctgtcgcgcgacaagctgatggaactggcccgcggacgcgaatac
gaggcgttcgaccgcagcctggatgtgcagatttcgcgtctgcgcaaattgatcgaaccc
aacccgtccaaacccgttttcatccaaaccgtctggggcctgggatacgttttcgttccg
gatggcggcagttga

DBGET integrated database retrieval system