KEGG   Bordetella bronchiseptica RB50: BB4530Help
Entry
BB4530            CDS       T00141                                 

Gene name
gatC
Definition
(GenBank) glutamyl-tRNA(GLN) amidotransferase subunit C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
bbr00970  Aminoacyl-tRNA biosynthesis
bbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BB4530 (gatC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bbr03029]
    BB4530 (gatC)
Enzymes [BR:bbr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BB4530 (gatC)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BB4530 (gatC)
Mitochondrial biogenesis [BR:bbr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BB4530 (gatC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-ProteinID: CAE34893
GeneDB: BB4530
UniProt: Q7WEV2
Position
4827279..4827644
Genome map
AA seq 121 aa AA seqDB search
MHTARFPSSATPSIFFRYSMALNEQDVARIARLARIELTPDQRGRAQAELNGILHLIERL
QAVDTQGVEPLAHPLSAHEDITLRLREDAVSEQATEASRAELLANAPESADGLFLVPKVI
E
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
gtgcatactgccaggttcccttcctccgctacgccctcgatttttttccggtattccatg
gcgctcaacgaacaagacgtggcccgcatcgcccggctggcccgcatcgaactgaccccc
gaccagcgtggccgggcccaggccgaactcaacggcatcctgcacctcatcgagcgcttg
caggccgtcgatacgcagggcgtcgagccgctcgcgcatcccctgtcggcccacgaggac
atcaccctgcgcctgcgcgaggacgccgtcagcgagcaggccaccgaggcgagccgcgcc
gaactgctggccaacgcccccgaatcggccgacggcctgttcctggtcccgaaagtaatc
gaatag

DBGET integrated database retrieval system