KEGG   Bordetella bronchiseptica RB50: BB4703Help
Entry
BB4703            CDS       T00141                                 

Definition
(GenBank) probable 2-oxo acid dehydrogenases acyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
bbr00010  Glycolysis / Gluconeogenesis
bbr00020  Citrate cycle (TCA cycle)
bbr00620  Pyruvate metabolism
bbr01100  Metabolic pathways
bbr01110  Biosynthesis of secondary metabolites
bbr01120  Microbial metabolism in diverse environments
bbr01130  Biosynthesis of antibiotics
bbr01200  Carbon metabolism
Module
bbr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bbr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BB4703
   00020 Citrate cycle (TCA cycle)
    BB4703
   00620 Pyruvate metabolism
    BB4703
Enzymes [BR:bbr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BB4703
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: CAE35065
GeneDB: BB4703
UniProt: A0A0H3M043
Position
complement(5003405..5004655)
Genome map
AA seq 416 aa AA seqDB search
MSQLNDLLMPKLGLTMTEGMLIEWSVTSGAEVKAGDSLFVVETDKVANEIVAQADGTLAE
ILVAAGETVPVGTVVARWTGPGQGADDLADAPPAPAPQPPQPAAEAAPAAAREPARGGRV
VATPLARRLAREAGLDLAQVSGSGPGGRIKAADVRQAPPALPVAPRDAASPAPAARASLA
PAAGEQRIEASALVQSMARRMTQAKQVPHFYLSAEAEVSALLALRQRLNAQADAPRLTLN
HFVIAAVARALAAMPHQNRIWNDDHIVQFQGIDVGVAVSTERGLMAPVLHGLDHASLDDI
AAQSGALLGRVRAGKATREDMSGGAISISNAGMFNVTYMAPIINPPQSAILGVGSIRELF
RPDEQGAPALRREMGLVLAADHRLHDGASALAFLNHVIDLLQDPYRLLRNRPHTKG
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgagccagttgaacgacctgctcatgcccaagctgggcctgaccatgaccgaaggcatg
ctgatcgagtggagcgtgaccagcggcgccgaggtcaaggcgggcgattcgctgttcgtg
gtggagacggacaaggtcgccaacgagattgtcgcgcaggccgacggcacgctggccgag
atcctggtcgccgccggcgagacggtgccggtgggcaccgtggtggcgcgctggaccggg
cccggccagggcgcggacgacctggccgacgcgccgccggcgccggcgccgcagccgccg
cagccggccgccgaggccgcgccggccgcggcgcgcgaacccgcgcgcggcgggcgcgtc
gtggccacgccgctggcgcggcgcctggcgcgcgaagccggcctggacctggcgcaggtc
agcggttccgggccgggcggacgcatcaaggccgccgacgtgcgccaggccccgccggcc
ttgccggttgcgccgcgggatgcggcttcgcctgcgccagccgcgcgcgcgtcgttggcg
cctgccgccggcgaacagcgcatcgaggccagcgcgctggtgcagtccatggcccggcgc
atgacgcaggccaagcaggtgccgcatttctacctctcggccgaggccgaggtcagcgcg
ctgctggcgctgcgccagcgcctgaacgcgcaggccgacgcgccgcggctgacgctcaac
cacttcgtcatcgcggcggtggcgcgcgcgctggcggccatgccgcaccagaaccgcatc
tggaacgacgaccacatcgtccagttccagggcatcgacgtgggcgtggcggtctcgacc
gagcgcggcctgatggcgccggtgctccacgggctggaccatgcctcgctggacgacatc
gccgcgcaatccggcgccctgctgggccgggtgcgcgccggcaaggccacccgcgaagac
atgagcgggggcgcgatttccatttccaacgccggcatgttcaacgtgacatacatggcg
cccatcatcaacccgccgcaatcggccattctcggcgtgggcagcatacgcgagctgttc
cggcccgacgagcagggcgccccggcgctgcggcgcgagatgggcctggtgctggccgcc
gaccaccggctgcacgacggcgccagcgcgctggcgttcctcaatcacgtcatcgacctg
ctgcaagacccgtaccggctgttgcgcaaccgaccccataccaaaggatag

DBGET integrated database retrieval system