KEGG   Bifidobacterium breve JCM 7019: B7019_0217Help
Entry
B7019_0217        CDS       T03121                                 

Definition
(GenBank) Glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
bbrc  Bifidobacterium breve JCM 7019
Pathway
bbrc00030  Pentose phosphate pathway
bbrc00480  Glutathione metabolism
bbrc01100  Metabolic pathways
bbrc01110  Biosynthesis of secondary metabolites
bbrc01120  Microbial metabolism in diverse environments
bbrc01130  Biosynthesis of antibiotics
bbrc01200  Carbon metabolism
Module
bbrc_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bbrc_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:bbrc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    B7019_0217
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    B7019_0217
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bbrc04147]
    B7019_0217
Enzymes [BR:bbrc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     B7019_0217
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     B7019_0217
Exosome [BR:bbrc04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   B7019_0217
  Exosomal proteins of colorectal cancer cells
   B7019_0217
  Exosomal proteins of bladder cancer cells
   B7019_0217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AHJ18547
UniProt: W6F6X7
Position
complement(276583..278121)
Genome map
AA seq 512 aa AA seqDB search
MSESPHWSNPLRDSRDLRLPRIAGPCSLVIFGVTGDLAQKKLLPAVYDLANRGLLPPSFG
LTGFARRDWTQERFIEFVKTAVQAHCRTPFKESTWRNLAAGIRFVQGTFDDPEAFERLSA
TVQELDRDRGTRGNHAFYMSVPPRAFPQVAKQLAASGLSRSSEGAWRRVIIEKPFGHDLA
SAKELDSVVSEVFDPNSVFRIDHYLGKETVQNLLALRFANAMYEPIWNANYVDHVQITMA
EDIGIGGRAGYYDGIGAARDVIQNHLLQLMALTAMEEPVSFTAKDLTAEKTKVLSAVRLP
KDLAANTARGQYAKGWQGSHEVVGYLEEKGIDPSSTTETYAAIRLDIDTRRWAGVPFYLR
CGKRLGKRVTEIAVVFKRAPHLPFEQTAVRELGKNAIVIRVQPDEGVTMRFGAKVPGGST
MEVRDVNMDFSYGRSFTENSPEAYERLILDVLLGDPPLFPTTEEVNLSWEILDPIEQFWA
TLGQPQAYRAGTWGPAQADEMLERDGRHWRMP
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaatccccccactggagcaatcccctgcgcgactcgcgcgacctccgattgccc
cgcatcgccggcccgtgcagcctcgttattttcggtgtcacgggtgatctggcacaaaag
aaactattgccggccgtttatgacttggcaaaccgtggcctattgccgccgagcttcggc
ctgaccggttttgcacgccgcgattggacccaggaacggttcatcgaattcgtcaagacc
gcggttcaggcacattgccgcaccccgttcaaagaatcgacctggcgcaatctggccgcc
ggcatccgttttgtgcagggcacgttcgacgaccccgaggcttttgagcgtctaagcgcc
actgtgcaggagcttgatcgcgaccgcggtacgcgcggcaatcatgccttttacatgtcg
gtgccgccgcgcgcattcccgcaagtggccaagcagctggccgcgtccggcctgtctcgt
tcgtccgaaggtgcatggcgccgcgtgattatcgagaagccgttcggccatgacttggcc
agcgccaaggaactcgacagcgtggtctccgaagtattcgacccgaactccgtgttccgc
atcgatcactacctcggcaaggaaaccgtgcagaacctgctggctctgcgctttgccaac
gccatgtacgagccgatctggaacgccaattatgtggatcacgtgcagatcacgatggcc
gaagacatcggcatcggcggccgcgccggctactacgacggcatcggcgccgcacgagac
gtgatccagaatcatctgcttcagctcatggcccttaccgccatggaagagccggtgagc
ttcaccgccaaggatctgaccgccgagaaaaccaaggtgctctccgctgtacgtctgccc
aaggatcttgccgccaataccgcacgcggccagtacgccaagggatggcagggttcgcac
gaagtggtcggatacctcgaagagaagggcatcgacccctccagcaccaccgaaacctat
gcggccatccgccttgacatcgacacccgccgttgggccggcgtgccgttctacctgcgc
tgcggcaagcgcctgggcaagcgcgtgaccgaaatcgctgtggtgttcaagcgcgccccg
cacctgccgttcgagcagaccgccgtgcgcgaactcggcaagaacgccatcgtgattcgc
gtgcagcccgatgaaggcgtcaccatgcgcttcggcgccaaggtgccgggcggctccacc
atggaggtccgtgacgtgaacatggacttcagctatggccgctccttcaccgaaaactcg
ccggaagcctatgagcgactgattctggacgtgctgctcggcgatccacctctgttcccg
accaccgaagaggtgaacctgagctgggaaatcctcgatccgattgaacaattctgggcc
acgctcggccagccgcaggcctaccgcgctggtacgtggggaccggcacaggccgatgag
atgctggaacgcgacggccgccactggaggatgccatga

DBGET integrated database retrieval system