KEGG   Bifidobacterium breve JCM 7017: B7017_1938Help
Entry
B7017_1938        CDS       T03120                                 

Definition
(GenBank) Mandelate racemase
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
bbrj  Bifidobacterium breve JCM 7017
Pathway
bbrj00051  Fructose and mannose metabolism
bbrj01100  Metabolic pathways
bbrj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bbrj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    B7017_1938
Enzymes [BR:bbrj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     B7017_1938
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N DUF3025
Motif
Other DBs
NCBI-ProteinID: AHJ18165
Position
complement(2030548..2031831)
Genome map
AA seq 427 aa AA seqDB search
MSTITKVKTYDFRFPTSTTLSGSDAMNPDPDYSSAYVEISTSADDGITGVGFVFTIGRGN
DVVCKAIESMSQVLIGRNTEELLDNMRIAWDLFVHDSQLRWLGPEKGVEHMAIGAVLSAL
WDIKAKRAGKPLWLLLGEMEPEELVSTLDFRYMTDALRPEEAVAILKEGQKGKAERIKHL
LEVGYPGYSTAPGWLGYSDEKMVALAKEETQVKGFKQIKLKVGQNINDDLRRLSKAREAI
GPDVRLAVDANQVWDVPTAIDWINKFHDFDLAWVEEPTSPDDVIGHATIARAINPIKVAT
GEQMQSRILYKQYLQANAFGIMQIDATRVAGPQEIVLEYLLAKKFNKPVCPHAGGVGLCE
AVCHFAMFDYVAVSGTMDGRMIEYVDNQHEHFAHPTEIKDGNYVAPTAPGNGTEMTLETT
EKYLYRC
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagtaccatcaccaaagtcaagacgtatgacttccgattccccacttcaacgacgctt
tccggctcggatgcaatgaaccccgatccggattattcctctgcgtacgtggagatttcc
accagcgccgacgacggcatcacgggtgtgggattcgtgttcaccatcggccgtggcaac
gacgtggtttgcaaggccatcgaatcgatgtcgcaggtgctgattgggcgcaacaccgag
gaactgctcgacaacatgcgcattgcatgggacctgttcgtgcatgattcccagctgcgt
tggcttggccctgaaaagggcgtggagcatatggccatcggcgcggtgctctccgcgttg
tgggatatcaaggccaagcgtgcgggcaagccgttgtggctgctgctgggcgagatggag
ccggaggagctggtctccacgctcgatttccgctacatgaccgacgccctgcgccctgag
gaagccgttgcgattctcaaagagggtcagaagggcaaggccgagcgtatcaagcatctg
ctggaggtcggttaccccggctattcaaccgctcccggttggctcggctactcggatgag
aagatggtggccctcgccaaggaggagacccaggtcaagggcttcaagcagattaagctt
aaggtcggccagaatatcaatgacgatctgcgccgcttgtccaaggcccgtgaggccatc
ggccccgatgtgcgcctcgccgtggacgccaaccaggtgtgggatgttcccaccgccatc
gactggatcaacaagttccacgacttcgatctggcgtgggtcgaggagccgaccagcccg
gatgacgtgattggccacgccacgattgcgcgcgccatcaatcccatcaaggtcgccacc
ggcgaacagatgcagagccgcattctgtacaagcagtacctgcaggccaacgccttcggc
atcatgcagattgacgccacccgagtggccggtccgcaggagatcgtgctcgaatacctg
ctggcaaagaagttcaacaagcccgtctgcccgcacgccggcggcgtgggtctgtgcgag
gccgtgtgtcacttcgcgatgttcgattatgtggcggtatccggcacgatggatggccga
atgattgaatatgtcgataatcagcacgaacatttcgctcatccgactgagatcaaggac
ggcaactacgtcgctccgaccgctccgggcaacggtaccgaaatgacgctggagacgacc
gagaagtacctgtatcgctgctga

DBGET integrated database retrieval system