KEGG   Bifidobacterium breve NCFB 2258: B2258_0654Help
Entry
B2258_0654        CDS       T03122                                 

Definition
(GenBank) Ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
bbrn  Bifidobacterium breve NCFB 2258
Pathway
bbrn00220  Arginine biosynthesis
bbrn01100  Metabolic pathways
bbrn01110  Biosynthesis of secondary metabolites
bbrn01130  Biosynthesis of antibiotics
bbrn01230  Biosynthesis of amino acids
Module
bbrn_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:bbrn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    B2258_0654
Enzymes [BR:bbrn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     B2258_0654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N Molydop_binding
Motif
Other DBs
NCBI-ProteinID: AHJ20868
Position
814616..815581
Genome map
AA seq 321 aa AA seqDB search
MTPELRHMLRDDDLSHEEQKQVLELAIKFSKNRFYKQPFAGPQAIAVLFDKPSTRTRSSF
SIGVAELGGYPLVIDKSGSQLGRGEPVADTARVLDRMAYGVVWRTFGQDRVEEMAKYSTH
PVVNALTDDFHPCQILADFQTIAEHRGGVDNLKNQTIAYLGDAANNMSNSYLLGGAVAGM
NVRVSGPQGYLPRPDIVADAERIAAENGGSILVTTDAREAVAGADCVFTDTWVSMGEEAE
YAIRSKPFWDYQVNAELMALAKPDALFQHCLPAYRGKEVTAEVIDGPQSVVWDEAENRLH
AQKALLTWLTGKARGDESLLA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaccccagaactgcgccatatgctgcgtgatgacgacctcagccatgaggagcagaag
caggtgcttgagcttgccatcaagttcagcaagaaccgtttctacaagcagccgtttgcc
ggtccgcaggccatcgccgtgctgttcgacaagccttccacccgtacccgctccagtttc
tccattggtgttgccgagcttggcggctacccgctggtcattgacaagtccggctcccag
ctgggccgtggcgagcctgtggccgataccgcccgtgtgctcgaccgtatggcctatggc
gtggtctggcgcacctttggtcaggatcgcgtggaggaaatggccaagtattccacccac
ccggtggtcaacgcgctgaccgatgacttccacccctgccagattcttgccgacttccag
accatcgccgaacaccgcggcggcgtggacaatctgaagaaccagaccatcgcctacctc
ggtgatgccgccaacaacatgtccaactcgtatctgctcggcggtgccgttgccggtatg
aacgtgcgtgtgtccggacctcagggctacctgccgcgtccggatatcgtggccgatgcc
gaacgcattgccgctgagaacggcggttccattctggtgaccactgatgcccgtgaggcc
gtcgccggtgccgattgcgtgtttactgacacctgggtttcgatgggtgaagaagctgaa
tacgccatccgatccaagccgttctgggattatcaggtcaatgccgagctcatggctctg
gctaagccggatgcgctattccagcactgcctgcccgcctatcgcggtaaggaagtcact
gccgaggtgattgatggcccgcagtccgtggtgtgggatgaggcggagaaccgtctgcac
gcgcagaaggcgttgctcacctggctgaccggcaaggcccgtggagacgaaagcctgctc
gcatga

DBGET integrated database retrieval system