KEGG   Bifidobacterium breve NCFB 2258: B2258_0831Help
Entry
B2258_0831        CDS       T03122                                 

Definition
(GenBank) Low-affinity inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
bbrn  Bifidobacterium breve NCFB 2258
Brite
KEGG Orthology (KO) [BR:bbrn00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    B2258_0831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AHJ21037
Position
1016378..1017430
Genome map
AA seq 350 aa AA seqDB search
MDVSLAHFLQQVLSNPALTVTTLLTLGVIFVNGWTDAPNAIATCVTTRCMRVRSAVIMAA
IFNFLGVFIMTQLNASVASTISNMVDFGGDTNAALIALCAALFSIVVYSVGASLLGIPTS
ESHSLIAGLSGAAIAIQGGIGGINMGEWVKVLYGLVASLLFGFAVGWLVCKAVTLICAGM
DRRRTNGFFTYAQIVGAAAMSFMHGAQDGQKFIGVLFLGMAFCNGQPSVTGVMIPVWLMI
LCSTIMGVGTSVGGERIIKSVGQDMVKLEKYQGFSADLSSALCLLVMTVLGIPVSTTHTK
TSAIMGVGAVRRLSAINFGVVRDMMLTWVFTFPGCGLISFVMAKLFMVVF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
ttggacgtctcactggcgcatttcctccaacaagtgctttccaacccggctctgaccgtc
acaacgttgctgacgctgggagtcatcttcgtcaacggctggaccgacgcacccaacgcc
atcgccacctgcgtgaccacgcgatgcatgcgcgtacgctccgccgtcatcatggcggcc
atcttcaacttcctcggcgtcttcatcatgacgcagctcaacgcttccgtggcctccacc
atcagcaacatggtcgatttcggcggcgacacgaacgcggcgctcatcgccctatgcgcg
gcgctgttctccatcgtcgtatacagcgtgggcgcctcgctgctcggcatacccacctcc
gaaagccacagcctgatcgccggcctgtccggagcggccatcgccatccaaggcggcatc
ggcggcatcaacatgggcgaatgggtcaaggtgctctacggtctggtcgcaagcctcctg
ttcggcttcgccgtcggctggttggtatgcaaggccgtgaccctgatttgcgctggcatg
gaccgccgccgcaccaacgggttcttcacctacgcgcagatcgtgggcgcggcggccatg
agcttcatgcatggcgcgcaggacggccagaagttcatcggcgtgctgttcctcggcatg
gcgttctgcaacggccaacccagcgtgaccggtgtgatgattccggtctggctcatgatt
ctgtgcagcaccatcatgggcgtaggtacgtccgtcggcggtgaacgcatcatcaaatcc
gtgggccaggacatggtgaaactcgagaaataccaaggcttctcggccgatctgtcaagt
gcgctgtgcctgctcgtcatgaccgtgctcggcatccccgtctccacaacgcacaccaag
accagcgccatcatgggcgtgggcgcggtacgccgcctctccgccatcaacttcggcgtg
gtgcgcgacatgatgctcacctgggtgttcaccttccccggttgcggtctcatcagcttc
gtaatggccaaactgttcatggtcgtgttctag

DBGET integrated database retrieval system