KEGG   Bordetella bronchialis: BAU06_00520Help
Entry
BAU06_00520       CDS       T04591                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bbro  Bordetella bronchialis
Pathway
bbro00071  Fatty acid degradation
bbro00072  Synthesis and degradation of ketone bodies
bbro00280  Valine, leucine and isoleucine degradation
bbro00310  Lysine degradation
bbro00362  Benzoate degradation
bbro00380  Tryptophan metabolism
bbro00620  Pyruvate metabolism
bbro00630  Glyoxylate and dicarboxylate metabolism
bbro00640  Propanoate metabolism
bbro00650  Butanoate metabolism
bbro00900  Terpenoid backbone biosynthesis
bbro01100  Metabolic pathways
bbro01110  Biosynthesis of secondary metabolites
bbro01120  Microbial metabolism in diverse environments
bbro01130  Biosynthesis of antibiotics
bbro01200  Carbon metabolism
bbro01212  Fatty acid metabolism
bbro02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bbro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BAU06_00520
   00630 Glyoxylate and dicarboxylate metabolism
    BAU06_00520
   00640 Propanoate metabolism
    BAU06_00520
   00650 Butanoate metabolism
    BAU06_00520
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BAU06_00520
   00072 Synthesis and degradation of ketone bodies
    BAU06_00520
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BAU06_00520
   00310 Lysine degradation
    BAU06_00520
   00380 Tryptophan metabolism
    BAU06_00520
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BAU06_00520
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BAU06_00520
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BAU06_00520
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bbro04147]
    BAU06_00520
Enzymes [BR:bbro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BAU06_00520
Exosome [BR:bbro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BAU06_00520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ANN64997
UniProt: A0A193FB34
Position
complement(117475..118656)
Genome map
AA seq 393 aa AA seqDB search
MSDPIVIVSVARTPMGGMLGSLSGLAAHELGSVVIKAAVERAGLKPEQVDEVLMGNVLQA
GQGQAPARQAALGAGLPLGVSCTTVHKVCGSGLKAAMLGHDLLAAGSAQVVVAGGQESMS
NAPYLLMKGRQGYRYGHSTVYDHMALDGLEDAYQRGTAMGVFAEDCASRYEFTRDQQDAF
STESLRRARAATEDGSFKWEIAPVTVAGRKGDTVIDTDEAPTKAMPEKIPTLKPAFKKDG
TVTAATSASISDGAAAMVLMRQSTAEKLGLRPLARIVGHAQHSQEPQWFTTAPIGALKNL
FKKTGWRAEDVDLYEINEAFAVVTMGVMKDFGIPHSKVNVHGGATALGHPIGASGARLVA
TLIGALRKNERKRGVATLCIGGGEAVAMAIEML
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatcccatcgtcatcgtttccgtcgcccgcacccccatgggcggcatgctgggc
agcctgtccggcctggccgcgcacgaactgggttccgtcgtcatcaaggccgccgtcgag
cgcgccgggctgaagccggaacaggtcgacgaagtcctgatgggcaacgtgctgcaggcc
ggccagggccaggccccggcgcggcaggccgcgctgggcgccgggctgccgctgggcgtg
tcctgcaccaccgtgcacaaggtctgcggatccggcctgaaggccgccatgctggggcac
gacctgctggccgccggttcggcgcaggtggtggtggccggcggccaggaaagcatgagc
aacgcgccctatctgctgatgaagggccgccagggctatcgctacggccattccacggtg
tacgaccacatggcgctggacggcctggaagacgcctaccagcgcggtaccgccatgggc
gtgttcgcggaagactgcgcctcgcgctacgagttcacgcgcgaccagcaggacgcgttc
tccaccgaatcgctgcgccgcgcccgcgccgccaccgaggacggcagcttcaagtgggag
atcgcgccggtcaccgtggccggccgcaagggcgatacggtcatcgataccgatgaagcc
ccgaccaaggcgatgccggagaaaatccccaccctgaagccggccttcaagaaggacggc
acggtcaccgccgcgacctcggcatccatctccgacggcgccgccgccatggtgctgatg
cggcagtccaccgcggaaaagctcggcctgcgcccgctggcgcgcatcgtcggccatgcg
cagcactcgcaggaaccgcagtggttcaccaccgcgcccatcggcgcgctgaagaacctg
ttcaagaagaccggctggcgcgccgaggacgtcgacctgtacgaaatcaacgaagccttc
gccgtcgtaacgatgggcgtgatgaaggacttcggcatcccgcacagcaaggtcaacgtg
catggcggcgccacggcgctgggccacccgatcggcgcctccggcgcgcgcctggtggcg
acgctgatcggcgcgctgcgcaagaacgagcgcaagcgcggcgtggccaccttgtgcatc
ggcgggggcgaagccgtggccatggccatcgagatgctgtaa

DBGET integrated database retrieval system