KEGG   Bordetella bronchialis: BAU06_02550Help
Entry
BAU06_02550       CDS       T04591                                 

Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
bbro  Bordetella bronchialis
Pathway
bbro00670  One carbon pool by folate
bbro00790  Folate biosynthesis
bbro01100  Metabolic pathways
Module
bbro_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bbro00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BAU06_02550
   00670 One carbon pool by folate
    BAU06_02550
Enzymes [BR:bbro01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     BAU06_02550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: ANN65329
Position
complement(588188..588682)
Genome map
AA seq 164 aa AA seqDB search
MTRMTLVVAYARNRVIGRDNGLPWKLPGDLAHFKRTTLGHPIVMGRKTWESLGRPLPGRT
NIVISRQAGYTAEGAVVVRDIDAALAAAAGSDEVFIIGGAQIYGAALDRAERIVATEIKA
DVDGDAWFPLLPGFRWREVSREPQAAENGYEYDFVVYERVPGAD
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgaatgacgctggtcgtggcctatgcccgcaaccgggtcatcgggcgcgacaac
ggcctgccttggaagctgccgggggacctggcgcatttcaagcggacgacgctgggccac
cccatcgtcatgggccgcaagacctgggaatcgctgggacgcccgctcccgggccgtacc
aacatcgtgatcagccgccaggccgggtacaccgccgaaggcgcggtcgtggtgcgggat
atcgacgccgcgctggccgcggcagccggatcggacgaggtcttcatcatcggcggggcg
caaatctatggcgccgcgctggatcgcgcggagcgcatcgtggccacggaaatcaaggcg
gacgtggacggcgatgcctggttcccgctgctgcccggtttccgctggcgggaagtatcc
cgcgagccgcaagccgccgaaaacggctacgagtacgacttcgtggtgtacgagcgggtt
cccggcgcggactga

DBGET integrated database retrieval system