KEGG   Bordetella bronchialis: BAU06_05665Help
Entry
BAU06_05665       CDS       T04591                                 

Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
bbro  Bordetella bronchialis
Pathway
bbro00970  Aminoacyl-tRNA biosynthesis
bbro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbro00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BAU06_05665
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bbro03029]
    BAU06_05665
Enzymes [BR:bbro01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BAU06_05665
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BAU06_05665
Mitochondrial biogenesis [BR:bbro03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BAU06_05665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ANN65849
UniProt: A0A193FFG7
Position
1274657..1276057
Genome map
AA seq 466 aa AA seqDB search
MSSVDAYASLEQTGRDLQSGALTSEALVRLRLDRIQRHDPALNAYMDVYADSALAAAKAA
DALRAAGVVLGPLHGITVAIKDLFDIAGRPVTCGSKSMPPRIPDRTATVVRKLQAAGAIV
LGKTQTVEFAFGGWGTNASFGTPRNPWDMQVHRVPGGSSSGSGVAVAAGLACAAIGTDTG
GSVRIPASMCGLVGLKTTVGLVSRDGLMPLSATLDTVGPMTHTVTDAALMLDAIAGPDPL
DASTRHAPARSVLPGLRDGVDGMRVWAMPDEERAGIDDAVLAAYEQALETLRTLGARVVR
RPLPRGSTDAMTMAGGIMAAEGYAALRAIGERDDLQVDPYVRRRILAGRGIGAAEYIDLL
RARERAKAEMMAAMVGTDFLLLPTTPLPAIPVQEADQATSTLARLNRMANLLDMCSVAVP
SGFTETGLPLSVQFAGRGMDEPVILRAAYAYEQATPWRARRPVGLD
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgagttctgtcgacgcctacgcctctcttgaacagactggccgcgatctgcaaagcggc
gccctgacgagcgaggcgctcgtccggctgcggctggatcgcatccagcggcacgatccc
gcgctgaacgcctatatggacgtctatgccgattcggccttggccgcggcgaaggcagcc
gatgccttgcgggcggccggcgtggtgctgggacccctgcatgggatcacggtcgccatc
aaggacctgttcgatatcgccggacggccggtgacctgcggctccaaatccatgccgccg
cgcatcccggaccgcacggccaccgtggtccggaagctgcaagccgccggcgcgatcgtg
ctgggcaagacccagacggtggagttcgccttcggcgggtgggggaccaacgcgtcgttc
ggcacgccgcgcaacccctgggatatgcaggtccaccgggtgccgggcggatccagcagc
ggctcgggcgtggcggtggcggccggtctggcctgtgccgctatcggcacggacacgggc
ggttcggtgcgcattccggcatccatgtgcggcctggtgggcctgaagaccacggtgggt
ctggtcagccgcgatggcctgatgccgctcagcgccacgctggacaccgtggggccgatg
acgcataccgtcaccgatgccgcgctgatgctggacgccatcgccgggcccgatccgctg
gatgcttccacgcgccatgcgcccgcgcggtcggtgctgccggggctgcgcgacggtgtc
gacggcatgcgggtctgggcgatgcccgacgaagaacgggccggcatcgacgatgccgtg
ctggccgcctacgagcaggcactggagacgctgcgcaccctgggcgcgcgcgtggtgcgg
cggcccctgccgcggggctccaccgatgccatgaccatggcgggagggatcatggcggcc
gaaggctatgccgccctgcgcgccatcggcgaacgcgatgacctgcaggtggatccctac
gtgcggcgccgcatactggcgggacggggcatcggcgccgccgaatacatcgatctgctg
cgggccagggagcgcgccaaggcggaaatgatggcggcgatggtgggtacggatttcctg
ctgctgcctaccacccctctgccggcgattcccgtgcaagaggccgaccaggcgacctcc
acgctggcgcgcttgaatcgcatggccaacctgctcgatatgtgttcggtggccgtgccg
tccggctttaccgagacgggtctgccgctgtcggtgcagttcgccgggcgcggcatggac
gaaccggtgatcctgcgcgccgcctatgcctacgagcaggccacgccctggcgcgcgcgc
cggcccgtgggcctggattga

DBGET integrated database retrieval system