KEGG   Bordetella bronchialis: BAU06_12855Help
Entry
BAU06_12855       CDS       T04591                                 

Definition
(GenBank) carnitine dehydratase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bbro  Bordetella bronchialis
Pathway
bbro00010  Glycolysis / Gluconeogenesis
bbro00053  Ascorbate and aldarate metabolism
bbro00071  Fatty acid degradation
bbro00280  Valine, leucine and isoleucine degradation
bbro00310  Lysine degradation
bbro00330  Arginine and proline metabolism
bbro00340  Histidine metabolism
bbro00380  Tryptophan metabolism
bbro00410  beta-Alanine metabolism
bbro00561  Glycerolipid metabolism
bbro00620  Pyruvate metabolism
bbro00625  Chloroalkane and chloroalkene degradation
bbro00903  Limonene and pinene degradation
bbro01100  Metabolic pathways
bbro01110  Biosynthesis of secondary metabolites
bbro01120  Microbial metabolism in diverse environments
bbro01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bbro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAU06_12855
   00053 Ascorbate and aldarate metabolism
    BAU06_12855
   00620 Pyruvate metabolism
    BAU06_12855
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BAU06_12855
   00561 Glycerolipid metabolism
    BAU06_12855
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BAU06_12855
   00310 Lysine degradation
    BAU06_12855
   00330 Arginine and proline metabolism
    BAU06_12855
   00340 Histidine metabolism
    BAU06_12855
   00380 Tryptophan metabolism
    BAU06_12855
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BAU06_12855
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BAU06_12855
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BAU06_12855
Enzymes [BR:bbro01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BAU06_12855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487 LuxC
Motif
Other DBs
NCBI-ProteinID: ANN67062
UniProt: A0A193FYS2
Position
complement(2910538..2912013)
Genome map
AA seq 491 aa AA seqDB search
MKRYQLFIDNEWVDPLSGAWFETHDPYSGVAWAEIPRANAADVDRAVAAAARAFQGPWSA
MSASDRGMLLHRLGALIERDARDLAAVESRDNGKLARDVLGQIKYMAKYYYYYGGLADKI
QGAVVPIDRPGVHNFIRYEPMGVVACITPWNSSLPLTTWKMAPALCAGNTVVCKPSEYTS
ASLFELARLFQEAGFPPGVFNIVTGFGAEAGDPLVRHPDVPRIAFTGGDEAGRRIYAAAA
QGLKRVSLELGGKSPNIVFDDADLDEAVKGVIAGIFSATGQTCVAGSRVLLQESIHDAFV
ERLAAITRGARVGDPADPASEIGPVTTRPQFEKIRDYIDIARKEGARCIAGGRTLSGPGY
GAGQFIEPTIFVDVTNDMRIAQEEVFGPVLSVLKFKDEEDAIRIGNDIRFGLAAGVWTTS
LHRAMLMSERLKAGTVWINNYRSSSYTTPFGGVKHSGIGREGGIESVKEFMEAKSVWIST
DLKMPKLFAGQ
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgctaccagctcttcatcgacaacgagtgggtggacccgctgtccggcgcctgg
ttcgagacccacgatccctactccggagtcgcctgggccgagatcccgcgcgccaacgcc
gccgacgtggaccgtgccgtggcggccgccgcccgcgccttccaggggccctggtccgcc
atgtcggccagcgaccgcggcatgctgctgcaccgcctgggcgcgctgatcgagcgcgat
gcgcgggacctggcggccgtggaaagccgcgacaatggcaagctggcgcgcgacgtgctg
ggccagatcaagtacatggccaagtattactactattacggcggcctggcggacaagatc
cagggcgcggtcgtgcccatcgaccggccgggggtgcataacttcatacgctacgaaccc
atgggcgtggtggcctgcatcacgccgtggaattcctccctgccgctgaccacgtggaag
atggcccccgcgctgtgcgccggcaataccgtggtctgcaagccctccgaatacacctcg
gcttcgctgttcgagctggcgcggcttttccaggaagccggcttcccgcccggcgtcttc
aacatcgtcacgggcttcggcgccgaggccggcgatcccctggtgcgccatccggacgtg
ccgcgcatcgccttcaccggcggcgacgaagccgggcgcaggatctacgcggcggccgcg
caaggcttgaagcgggtctcgctggaactgggcggcaagtcgcccaacatcgtgttcgac
gacgccgacctggacgaagccgtcaagggcgtcatcgccgggatattctccgccacgggc
cagacctgcgtggcgggctcgcgggtactgctgcaggaatccatccacgacgctttcgtc
gagcgcctggccgcgatcacccgcggcgcccgcgtgggcgatccggccgacccggccagc
gaaatcggcccggtgaccacgcgtccccagttcgagaagatccgcgactatatcgacatt
gccaggaaggaaggcgcgcgctgcattgccggcggccggacgctgagcgggccgggctac
ggcgcgggacagttcatcgaaccgacgattttcgtggacgtcaccaacgacatgcgcatc
gcgcaggaagaagtcttcggccccgtactgtcggtgctgaagttcaaggacgaggaggac
gccatccgcatcggcaacgatatccgcttcggcctggcggccggcgtatggaccaccagc
ctgcatcgcgccatgctgatgtccgagcgcctgaaggccggcacggtgtggatcaacaac
taccggtccagcagctacactacgccgttcggcggggtcaagcacagcggcatcggccgc
gaaggcggcatcgagtcggtaaaggaattcatggaagccaagagcgtctggatttccacc
gatctgaaaatgcccaaacttttcgccgggcaatga

DBGET integrated database retrieval system