KEGG   Bordetella bronchialis: BAU06_24400Help
Entry
BAU06_24400       CDS       T04591                                 

Definition
(GenBank) selenide,water dikinase SelD
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
bbro  Bordetella bronchialis
Pathway
bbro00450  Selenocompound metabolism
bbro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbro00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BAU06_24400
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bbro03016]
    BAU06_24400
Enzymes [BR:bbro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     BAU06_24400
Transfer RNA biogenesis [BR:bbro03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    BAU06_24400
 Prokaryotic Type
    BAU06_24400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: ANN69027
UniProt: A0A193G2E4
Position
complement(5558572..5559636)
Genome map
AA seq 354 aa AA seqDB search
MTQDASAGAAPRLTSLSHGGGCGCKIAPGVLADLLARFAPSQAFPGLMVGTETADDAAVY
RLNDEQALIATTDFFMPIVDDPYDFGRIAATNALSDVYAMGGTPIMALAIVGMPINVLPR
ETIAEILRGGQEVCAQAGIPVAGGHTIDSVEPIYGLAAMGLVHPARVKRNADARPGDALI
LSKPLGVGILSAALKKNQLDAAGYQAMIASTTRLNTPGPALAALPGVHALTDVTGFGLLG
HALEMSRGAGLRARIDLAALPWLPGVRQMAQAGMITGASGRNWASYGDAIALAPGVDEVS
RALLTDPQTSGGLLVACDRDTAPRVLDVLREQGFTQAAVVGEMALGEPGVEVAG
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgacccaagacgcaagcgcgggcgcggcgccgcgcctgacttcgctttcgcacggcggc
ggctgcggctgcaagatcgccccgggagtcctggccgatctgctggcccgcttcgcgccg
tcgcaggcctttcccggcctgatggtgggcaccgagaccgcggacgacgcggcggtgtac
cgcctgaacgacgagcaggcgctgatcgccaccaccgacttcttcatgcccatcgtcgac
gatccctacgatttcggccggatcgccgccaccaatgcgctctcggacgtctatgccatg
ggcggcacgcccatcatggcgctggccatcgtcggcatgcccatcaatgtgctgccacgc
gaaaccatcgccgagatcctgcgcggcggccaggaagtctgcgcgcaggccggcatcccg
gtggccggcggccacaccatcgattcggtcgagcccatctacgggctggctgccatgggg
ctggtgcatccggcgcgcgtcaagcgcaatgccgatgcgcgccctggcgacgcgctgatc
ctgagcaagccgctgggcgtgggcatcctgtcggccgcgctcaagaagaaccagctggat
gccgccggctaccaggccatgatcgccagcaccacgcgcctgaacacgccgggaccggcc
ctggcggccctgcccggcgtacatgccctgaccgacgtcaccggcttcggcctgctgggt
cacgcgctggagatgagccgcggcgctggcctgcgcgcccgcatcgatctcgccgcgctg
ccgtggctgcccggcgtgcggcagatggcgcaagccggcatgatcaccggcgcctccggc
cgcaactgggcttcctatggcgatgccatcgcgctggcgcccggcgtggacgaggtctcg
cgtgcgctgctcacggatccgcagacctccggcggcctgctggtggcctgcgaccgcgat
accgcgccgcgcgtgctggacgtcctgcgcgaacagggattcacgcaggcggccgtggtg
ggcgaaatggccctgggcgaaccgggggtggaggtagccggctga

DBGET integrated database retrieval system