KEGG   Bifidobacterium breve UCC2003: Bbr_0020Help
Entry
Bbr_0020          CDS       T02534                                 

Definition
(GenBank) Glycosyl hydrolases family 32, Beta-fructosidase or sucrose-6-phosphate hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
bbru  Bifidobacterium breve UCC2003
Pathway
bbru00052  Galactose metabolism
bbru00500  Starch and sucrose metabolism
bbru01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Bbr_0020
   00500 Starch and sucrose metabolism
    Bbr_0020
Enzymes [BR:bbru01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     Bbr_0020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N DUF4975 Glyco_hydro_32C Laminin_G_3 DUF1155
Motif
Other DBs
NCBI-ProteinID: ABE94736
UniProt: F9XZD9
Position
28215..29612
Genome map
AA seq 465 aa AA seqDB search
MPKLYYQFPGTWFGDCMPFGKGNEFFLYHQRDNRNPEPFGEPFGWDLATTSDFVHYKDCG
VAVPRGRDDEQDQFIFAGSVFEGEGQYHIFYTGYNRDYPQRDKPAQVLMHAVSDDLYHWT
KTQNAITFTPQEGYDPDDWRDPWVIRDDEHDQYLLILGARKIGPKTQQTGRTVKFTSKDL
KNWTFEGDFWAPNLYTMHEMPDLFKMGEWWYHIVTEYSDRHKMVYRMAKSLEGPWIAPDD
DAFDGSAYYAGRTFELGGRRILFGWVATKEDCDDVKNFEWAGTFVPHEVYQRTDGTLGVR
IPDTVWDAFNEREQIVTNAVIDGTDARRNAVLAEGCGDLYSFEADVMFSEGTRSFGLRVY
RDEASERGYQFIFPIGEHRYVFEGSPNFPWFNCMNIGLERPIELVAGREYHIQLIVDDTI
ATLYVNGVALNARMYQHPGDALSMFVTDGTLTVTNATISRGLKEV
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagctgtactaccaattccctggcacgtggttcggcgattgcatgccgttcggc
aagggcaacgagttctttctgtatcaccagcgagacaatcgcaatccggaaccattcggc
gaaccgttcggctgggatctggccacaacctctgatttcgtgcattacaaggattgcggt
gtagccgtgccgcgcggcagggacgacgagcaggatcagttcatattcgcgggatcggtg
tttgaaggggaagggcaataccatatcttctacaccgggtacaaccgcgattacccccag
cgggacaagccggcgcaggtgctgatgcacgcagtcagcgatgatttgtaccactggacg
aaaacccagaacgccatcaccttcactccgcaagaaggctacgatccagacgattggcgc
gacccgtgggtcattcgcgacgacgaacatgaccagtatctgctaatccttggagcccgt
aagatcggcccgaaaacgcagcagaccggccgcacggtgaagttcacgtctaaagacctc
aagaactggacgttcgaaggtgacttctgggctccgaacctatacacgatgcatgagatg
cctgatctgttcaagatgggcgagtggtggtatcacatcgttacggaatacagcgatcgg
cacaagatggtgtatcgcatggccaagagtctagaaggcccgtggatcgcacccgatgat
gacgcgtttgacggcagcgcctattatgccggacggaccttcgaactaggtggacggcga
atcctcttcggctgggttgccaccaaggaagactgcgatgacgtaaagaacttcgaatgg
gctggcaccttcgtccctcacgaggtctaccagcgtaccgacggcacacttggcgtgcgc
attcccgacacggtctgggatgcgttcaacgaacgcgagcaaatcgtgacgaatgcggta
atcgacggtactgacgctcgccgtaacgccgtgctggccgagggctgcggagacctgtat
tcgtttgaagcggacgtcatgttcagcgagggaacgcgatccttcggtctccgcgtctac
cgcgatgaggcaagcgagcgtggctatcagttcatcttcccgattggtgagcatcgctac
gtattcgaaggcagcccgaacttcccgtggttcaactgtatgaatatcgggctagagcgg
ccaatcgaactggttgccgggcgtgaatatcacattcagctcatcgtggacgacaccatc
gccactctgtacgtcaatggcgtcgcactcaacgcgcgtatgtaccagcacccaggcgac
gcattaagcatgttcgtcaccgacggcacgctcaccgtcacgaatgcgaccatcagtcgt
ggactcaaggaggtgtga

DBGET integrated database retrieval system