KEGG   Bifidobacterium breve UCC2003: Bbr_1869Help
Entry
Bbr_1869          CDS       T02534                                 

Gene name
aga
Definition
(GenBank) Alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
bbru  Bifidobacterium breve UCC2003
Pathway
bbru00052  Galactose metabolism
bbru00561  Glycerolipid metabolism
bbru00600  Sphingolipid metabolism
bbru01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbru00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Bbr_1869 (aga)
  Lipid metabolism
   00561 Glycerolipid metabolism
    Bbr_1869 (aga)
   00600 Sphingolipid metabolism
    Bbr_1869 (aga)
Enzymes [BR:bbru01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Bbr_1869 (aga)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_36N Glyco_hydro_36C GHL10 Glyco_hydro_31 Melibiase_2 Glyco_hydro_97
Motif
Other DBs
NCBI-ProteinID: ABE96531
UniProt: F9XZV1
Position
complement(2342034..2344349)
Genome map
AA seq 771 aa AA seqDB search
MAQNTATFTGTAADGTALTAIYLVQPDANVAIGLVAAGDDLPRIIHWGRPLSNPETLLAA
YDALKPQRVSGALDDTAWPSILPTQAESWIGEQRVVLRRDGIELFPKFTVTGMKFDGVVA
ASLDAVSGDSYTDVTGRARTTGPANVPGVAITARDEEQGVELEWHLELLPGGLARQKAIV
TNLFGAEAGAEAPLEIGKIELGFPLPESASEILTTTGHHLRERSPQRQPLTIGRFEKPQL
AGRPDFDASLLLTAGVPGFGFEHGEAYSVHVGWSGNSVLSAERLPYTQGVIGGGELLFGG
EVTLDDAAGEGQSSYETPWLFGSFGDGLNEIAARFHSYVRSLHPRLFSHGRPVILNTWEA
VYFDHNFDTLKALADKAAASGVERFVVDDGWFGSRRDDTSGLGDWQISQDVWPDGPKSLK
ALADYVHAKGMEFGLWFEPEMVNPDSDVARNHPDWILSPTAGRLPLQGRTQQVLDLTNPE
AFDYIYSCMDQLVGELGIDYIKWDHNKLVTEPGSRRSGRPAVHAQTIAVYEIFRGLKTAH
PGLEIESCSSGGGRVDLGILEYADRIWVSDCVDPVERADIQRYTSLLVPPAMMGEHVGAS
PAHSTRRETSQELRMAMAFFGHMGIEWNLLKEPDDALAKLAVWVAEFKKHRDWFAIDTCV
HADSSDPAVRLDGMVMPNRNAAIYRFAQLTTSQTYPAAPVHLPGLDPKRKYRISPLDPSL
DLEGLTNGQSTLGWWNEEGVVLTGEALQRYGIRPPSLHPQQAVLFKAVALS
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
atggcccagaacaccgccaccttcaccggtaccgccgctgacggaaccgcgctcaccgcc
atctatcttgtacagcccgatgccaacgtggcaatcggtctggtcgctgccggcgatgac
ctgccgcgtatcattcattggggtcgcccgctgagcaatcctgagaccttgctcgctgcg
tatgatgcactcaagccgcagcgcgtttccggtgcactcgatgacaccgcctggccgtcc
atcctgccgacacaggccgaaagctggattggcgagcagcgtgtggtgctgcgccgcgac
ggcatcgaactcttccccaagttcaccgtgaccggtatgaaattcgacggcgtggtggct
gctagcctcgatgctgtgtccggcgacagctacaccgatgtgactggacgtgcccgtacc
actggcccggccaacgtgcccggcgtggcaatcactgcgcgcgacgaagagcaaggcgtg
gaactcgaatggcatctcgaacttctgcccggtggtttggcccgtcagaaggccatcgtg
accaacctgttcggagcagaagccggtgccgaggccccgctggaaatcggcaagatcgag
ctcggtttcccgctacccgaatccgcatccgaaatcctgaccaccaccggccaccatctt
cgcgaacgcagcccgcagcgtcagccgctcaccatcggacgttttgagaagccgcagctc
gcgggtcgccctgatttcgacgcctccctgctgcttaccgccggcgttcccggcttcggc
ttcgagcatggcgaagcctactcggtgcacgtgggctggagcggcaactccgtgctgtcc
gccgagcgactgccgtacacgcagggtgtgattggcggcggcgagctgctgtttggcggc
gaagtaacgcttgatgatgcagccggcgaaggccagagctcttacgaaaccccatggctg
ttcggctccttcggcgatggtctgaacgagattgccgcacgcttccactcctatgtgcgt
tctttacacccgcgcttgttctcgcacggccgtccggtaatcctcaacacctgggaagcc
gtgtacttcgaccacaacttcgatacgctcaaggcgctcgccgacaaggcagccgcttct
ggtgtggaacgattcgtggtggatgacggttggttcggttctcgccgcgacgacacctcc
ggccttggcgactggcagatttctcaggacgtatggcccgatggcccgaagtccctcaag
gcgctcgccgattatgtgcatgccaagggcatggagttcggcctgtggttcgagccggaa
atggtcaaccccgattccgacgtggcccgcaaccaccctgattggattctttcgcccact
gccggccgtctgccgctgcagggccgcactcagcaagtgctcgacctgaccaatccggaa
gctttcgattacatttacagctgcatggatcagctcgtcggcgagctcggcatcgactac
atcaaatgggatcacaacaagctggtcactgagcccggttctcgccgctccggccgtccg
gccgtgcatgcgcaaactattgccgtctatgagattttcaggggcctcaagaccgctcac
ccgggtctcgaaatcgaaagctgctcttccggtggcggccgtgtggatctcggtatcctc
gaatacgccgaccgtatctgggtgtccgattgcgtggatccggtcgaacgcgcggacatc
cagcgttacacatcactgcttgtgccgcctgccatgatgggcgagcatgtgggtgccagc
cccgcgcactccactcgtcgtgagaccagtcaggaattgcgcatggcgatggcattcttc
gggcacatgggcatcgaatggaacctgctcaaggagccggacgatgcacttgccaagctg
gcagtgtgggtggccgagttcaagaagcatcgtgattggttcgccatcgatacctgcgtg
cacgccgactccagcgatccggccgtgcgcctcgatggcatggtgatgccgaaccgcaat
gctgccatctaccgcttcgcccagctgaccacgagccagacctatcctgccgctcccgtg
catctgcctggccttgaccccaagcgcaagtatcgcattagcccgctcgacccaagcctg
gacctcgaaggtctgaccaatggtcaaagcaccctcggttggtggaacgaagaaggcgta
gtcctgaccggcgaagccctgcagcgctacggcatccgtcccccgtccctccaccctcag
caggcagtactgttcaaggccgtggcgttaagctga

DBGET integrated database retrieval system