KEGG   Bifidobacterium breve 689b: B689b_0858Help
Entry
B689b_0858        CDS       T03119                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
bbrv  Bifidobacterium breve 689b
Pathway
bbrv00520  Amino sugar and nucleotide sugar metabolism
bbrv01100  Metabolic pathways
bbrv01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bbrv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    B689b_0858
Enzymes [BR:bbrv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     B689b_0858
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: AHJ22892
Position
complement(1046381..1047625)
Genome map
AA seq 414 aa AA seqDB search
MDRQQIVAQVTDSMEGAPSAFAIRDARKVDARGIEEHAWIVADANGAIAARGTSDDDFEA
ACRANGIGTDAVIDASGKIMTPGYVDIHSHGAWEKSFDDGPDGIDVARAGHAMHGTTRQV
CSLITNPIDVQCENLRNVRAKMDQRPDILGAHLEGPFLALSRKGAHDPECLKDPVPEIVD
RMLEAADGCLRQITIAPELPHGLQAIRSFATVGTVPAVGHCDADYETARRAFDEGAGLMT
HMFNAMNGLHHRKPGPIPAAVEDPRVTIELICDGFHVQDPMLRLGLGFAPHRIAFVTDAM
AATDCPDGAYKLGALDVDVVDGHARLKSNGAIAGSTLTLEHAVQRAVLELGMSPVEAIEA
ATLTPARAFGFDRPYPVTGAPLGLLAPGYAADVLLTDPADWSVQHAWCAGRRIK
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggacagacaacagatcgtcgcgcaggtgacggactcgatggagggcgcgccgtcggcc
ttcgcgattcgggacgcgcgcaaagtcgacgcccgcggcatcgaggaacatgcttggatc
gtggccgacgccaatggcgcgatcgcggcgcgaggcacgtcggatgacgatttcgaggcc
gcctgccgtgcgaatggcatcggaacggatgcggtcatcgatgcctcgggcaagatcatg
acccccggatacgtggacatccattcgcacggcgcgtgggagaaaagctttgacgacggc
ccggatggcatcgatgtggcgcgcgccgggcatgcgatgcatggcacgacccgtcaggtg
tgttcgctgatcacgaatccgatcgacgtgcagtgcgagaatctgcgcaatgtacgagcc
aagatggatcaacgccccgatatcctcggcgcgcatctggaggggccgttcctcgcgttg
tcgcgcaagggtgcgcacgatccggaatgcctcaaggacccggtgcccgagatcgtggac
cggatgctcgaggccgccgacggctgcctgcgccagatcacgatcgccccggagctgccg
cacgggctccaggccatccgcagcttcgcgaccgtcggcaccgtgcccgcggtcggccat
tgcgatgccgactacgagaccgcccgccgcgcctttgacgaaggcgccggcctgatgacg
catatgttcaacgcgatgaacggtctgcaccatcgcaagcccggtccgattccggcggcg
gtcgaggatccgcgcgtcaccatcgagctgatctgcgacggcttccatgtgcaggatccg
atgctgcggcttggccttggtttcgcgccgcatcgcatcgccttcgtcaccgacgcgatg
gccgccaccgactgcccggacggcgcctacaagctcggcgcgctcgacgtggacgtggtc
gacggacacgcccgactcaagtccaatggcgcgatcgccggctccacgttgaccctcgag
cacgccgtgcaacgcgcggttctcgaactgggcatgtccccggtcgaggccatcgaggca
gccacgctgaccccggcgagggccttcggattcgaccggccgtatccggtcaccggcgca
cccctcggtctgctcgcccccggatacgccgccgacgtgctgctcactgaccccgccgac
tggtccgtccaacacgcctggtgcgcggggcggcgaatcaagtaa

DBGET integrated database retrieval system