KEGG   Bifidobacterium breve 689b: B689b_1452Help
Entry
B689b_1452        CDS       T03119                                 

Definition
(GenBank) Beta-glucosidase
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
bbrv  Bifidobacterium breve 689b
Pathway
bbrv00460  Cyanoamino acid metabolism
bbrv00500  Starch and sucrose metabolism
bbrv01100  Metabolic pathways
bbrv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bbrv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    B689b_1452
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    B689b_1452
Enzymes [BR:bbrv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     B689b_1452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3_C Glyco_hydro_3 Fn3-like
Motif
Other DBs
NCBI-ProteinID: AHJ23447
Position
complement(1716905..1719178)
Genome map
AA seq 757 aa AA seqDB search
MSESTYPSVKDLTLEEKASLTSGGDAWHLQGVESKGIPGYMITDGPHGLRKSLASSAGET
DLDDSVPATCFPPAAGLSSSWNPELIHKVGEAMAEECIQEKVAVILGPGVNIKRNPLGGR
CFEYWSEDPYLAGHEAIGIVEGVQSKGVGTSLKHFAANNQETDRLRVDARISPRALREIY
FPAFEHIVKKAQPWTIMCSYNRINGVHSAQNHWLLTDVLRDEWGFDGIVMSDWGADHDRG
ASLNAGLNLEMPPSYTDDQIVYAVRDGLITPAQLDRMAQGMIDLVNKTRAAMSIDNYRFD
VDAHDEVAHQAAIESIVMLKNDDAILPLNAGPVANPSATPQKIAVIGEFARTPRYQGGGS
SHITPTKMTSFLDTLAERGIKADFAPGFTLDLEPADPALESEAVETAKNADVVLMFLGLP
EAAESEGFDRDTLDMPAKQITLLEQVAAANQNVVVVLSNGSVITVAPWAKNAKGILESWL
LGQSGGPALADVIFGQVSPSGKLAQSIPLDINDDPSMLNWPGEEGHVDYGEGVFVGYRYY
DTYGKAVDYPFGYGLSYATFEITGVAVAKTGANTATVNATVTNTSDVDAAETVQVYVVPG
KADVARPKHELKGFTKVFLKSGESKTVTIDLDERAFAYWSEKYNDWHVEAGEYAIEVGVS
SRDIADTVAVALDGDGKTQPLTEWSTYGEWEADPFGAKIVAAVAAAGEAGELPKLPDNAM
MRMFLNSMPINSLPTLLGEGGKKIAQFMVDEYAKLSK
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagtccacctacccgtccgtcaaggatctgaccctggaagagaaggcatccctc
acctccggcggcgacgcctggcatctgcagggcgtggagtccaaaggcatcccaggctac
atgatcactgacggtcctcacggtctaaggaagtccctggcctccagcgccggtgagacc
gaccttgacgactccgtgcccgccacctgcttcccgccggccgccggcttgtccagctct
tggaatcctgagctcattcacaaggttggtgaggcgatggctgaggagtgcattcaggag
aaggtggctgtgattcttggccccggcgtcaatatcaagcgcaacccgctcggcggtcgc
tgcttcgaatactggtccgaagacccgtacttggccggtcatgaggccatcggcattgtt
gaaggcgtgcagtccaagggcgtgggcacgtcgctcaagcacttcgccgccaacaatcag
gaaaccgaccgactgcgcgtcgatgcccgcatcagcccgcgcgccctgcgcgagatctac
ttcccggccttcgaacacatcgtcaagaaggcccagccgtggaccatcatgtgctcctac
aaccgcatcaacggcgtgcattccgcacaaaaccattggctgctgaccgacgtgctgcgc
gacgaatggggcttcgatggcatcgtcatgtccgactggggcgccgatcatgaccgtggg
gcctccctgaatgcaggcctgaatctggaaatgccgccgagctacaccgacgaccagatt
gtctacgccgtccgcgacggcctaatcacccccgcccagctcgatcgtatggctcagggc
atgattgacttggtaaacaagacccgcgctgcaatgagtatcgataattaccgtttcgat
gtggacgcccacgatgaagtcgcccatcaggccgctattgaatccattgtgatgctcaag
aacgatgatgcgattctgccgctgaacgccggtccagtcgccaatccgtccgccacgccc
cagaagatcgccgttatcggcgaattcgcccgcaccccgcgctaccagggcggcggctcc
tcccacatcacccccaccaagatgaccagcttcctcgacacgctcgccgagcgcggcatc
aaggccgacttcgcccccggcttcacgctcgatctggaaccggccgacccggccctcgaa
tccgaagccgtggaaaccgccaagaacgccgacgttgtcctcatgttcctgggcctgccg
gaagccgcggaatccgaaggcttcgaccgcgacaccctcgacatgcccgccaagcagatc
accctactcgaacaggtcgccgccgcgaaccagaacgtcgtggtcgtactgtccaacggt
tccgtgatcaccgtggccccgtgggccaagaacgccaagggcatcctcgaatcctggttg
ctcggccagtccggtggcccggcgctcgccgatgtgatcttcggccaggtcagcccgtcc
ggcaagctcgcccagtcgattccgctggacatcaacgatgacccgagcatgctgaactgg
ccgggcgaggaaggccacgtcgactacggcgagggcgtgttcgtcggttaccgctactac
gacacctacggcaaggctgtcgactacccgttcggctacggcctgagctacgccacgttc
gagatcaccggtgtcgccgttgccaagaccggcgcgaacaccgccaccgtgaatgccact
gtgaccaacacctccgatgtggacgctgccgaaaccgtgcaggtgtacgttgtgccgggc
aaggccgacgtggctcgcccgaagcacgagctcaagggcttcaccaaggtgttcctcaag
tccggtgagtccaagaccgtgaccatcgacctcgacgagcgcgcgttcgcctactggtcc
gaaaagtacaacgactggcacgtggaggccggcgaatatgccatcgaagtgggcgtgagc
tcccgcgacattgccgacaccgttgccgtggccctcgatggcgacggcaagacccagccg
ctcaccgaatggtccacctacggcgagtgggaggccgatccgttcggcgccaagatcgtg
gccgccgtggccgccgccggcgaggccggcgagctgccgaagcttccggataatgcgatg
atgcgcatgttcctcaactccatgcccatcaactcgctgcccaccctgctgggcgaaggc
ggcaagaagatcgcccagttcatggttgacgagtacgccaagctgagcaagtaa

DBGET integrated database retrieval system