KEGG   Bifidobacterium breve 689b: B689b_1592Help
Entry
B689b_1592        CDS       T03119                                 

Definition
(GenBank) Dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
bbrv  Bifidobacterium breve 689b
Pathway
bbrv00670  One carbon pool by folate
bbrv00790  Folate biosynthesis
bbrv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbrv00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    B689b_1592
   00670 One carbon pool by folate
    B689b_1592
Enzymes [BR:bbrv01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     B689b_1592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: AHJ23579
Position
complement(1892980..1893642)
Genome map
AA seq 220 aa AA seqDB search
MEHDSSRSGYHEPEPGSAGLSATEEDWGDDFPKTFSVNLIWAQARDKEGRAGAIGLNGGM
PWHCAEDMKHFKELTVSHPVIMGRKTWESLGVKYRPLPNRDNIVISHDPMYRAPGATVVT
GLDDALDLARQEAIPDDGLDRSEIWVIGGAQLFSEALPFADKAYVTDLDATVDADAYAPD
VESLVEAGLWHEAEAGEWLTPAKDEPGIAAYRFRILRKTK
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggagcatgacagtagccgtagcggctatcacgaacccgagcccggatctgccgggctg
tctgccactgaagaagactggggcgatgatttcccaaagactttctcggtgaatcttatt
tgggctcaggcccgcgacaaggaaggtcgcgctggcgccatcgggctcaacggcggtatg
ccttggcattgtgctgaagacatgaagcatttcaaggagctgaccgtctctcatccggtg
attatgggccgtaagacctgggaatcgcttggtgtgaagtaccgtccgttgcccaaccgt
gacaacattgtgatttcccatgatccgatgtatcgtgcgccgggggcgaccgtggtcacc
ggccttgatgatgcgcttgatctggctcgtcaggaggcgattccggatgacggtctggat
cgttctgagatttgggtcatcggaggtgcacagctgttctccgaggcgctgccgtttgcg
gataaggcctatgtgaccgatcttgacgccactgtggatgccgatgcctatgctccggat
gtcgaatcgctggttgaagcagggctttggcatgaagccgaagcaggggagtggctcacg
cccgcgaaggatgagcccggcatcgccgcgtaccgtttccgcatcttgcgcaagaccaag
tga

DBGET integrated database retrieval system