KEGG   Borreliella bissettii: BbiDN127_0206Help
Entry
BbiDN127_0206     CDS       T01593                                 

Gene name
gtaB
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bbs  Borreliella bissettii
Pathway
bbs00052  Galactose metabolism
bbs00500  Starch and sucrose metabolism
bbs00520  Amino sugar and nucleotide sugar metabolism
bbs01100  Metabolic pathways
bbs01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bbs00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BbiDN127_0206 (gtaB)
   00052 Galactose metabolism
    BbiDN127_0206 (gtaB)
   00500 Starch and sucrose metabolism
    BbiDN127_0206 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    BbiDN127_0206 (gtaB)
Enzymes [BR:bbs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BbiDN127_0206 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AEL18392
UniProt: G0AL16
Position
208234..209070
Genome map
AA seq 278 aa AA seqDB search
MKGIILAAGYGTRFLPITKTIPKEMLPILNKPAIDYIIQEFIDSGIKDILLISSRRKKVL
EDYFDREIELENIFLKENKKDELDKIKTKKINISFIRQKEMLGTGNALLYAKPWINREPV
IVAYPDDLCIGNPPLSLQLINLYEKTGKSIISIIENPENINKYGVIELYKDEIHVKNIVE
KPKIGSEPSNKASIGRFLYNYEFFEHLEEGFKLHQKGEYYHIYALKKLMDQKKVLYKNIE
GKRIDIGTLEGYLEAIINFAQKDKNLMEIIKKGINEND
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggcattattctggcggctgggtatggtacaagatttttaccaataacaaaaaca
attccaaaagaaatgctaccaattttaaacaaaccagccatagattatattattcaagaa
tttatcgattcaggaataaaagacattttattaataagttcaagacgaaaaaaagttctt
gaagattattttgacagagaaattgaacttgaaaatatttttttaaaagaaaataaaaaa
gatgaattagataagattaaaaccaaaaaaattaacataagcttcataaggcaaaaagaa
atgctaggcacaggaaatgcactgctttatgcaaaaccctggataaatagagagcctgtg
attgtagcttaccctgatgatctttgcattggaaatccaccattaagcttacaattgatc
aatctttatgaaaaaactggaaagagcataatatctatcattgaaaatccagaaaatata
aataaatatggtgtaatagaactctacaaagacgaaattcatgtaaaaaacattgttgaa
aaaccaaaaattggaagtgaacccagtaataaagcatctattgggagatttttgtacaat
tatgagttttttgaacatttagaagaaggattcaaactacaccaaaaaggtgaatactac
cacatttatgctttaaaaaagctaatggatcaaaaaaaagtattatataaaaatattgaa
ggaaaaagaattgacataggaactcttgaaggttatttagaggcaataataaattttgcc
caaaaagataaaaatttaatggaaattataaaaaaaggaataaatgaaaacgattaa

DBGET integrated database retrieval system