KEGG   Bradyrhizobium sp. BTAi1: BBta_0180Help
Entry
BBta_0180         CDS       T00528                                 

Gene name
gshB
Definition
(GenBank) glutathione synthase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
bbt00270  Cysteine and methionine metabolism
bbt00480  Glutathione metabolism
bbt01100  Metabolic pathways
Module
bbt_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:bbt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BBta_0180 (gshB)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BBta_0180 (gshB)
Enzymes [BR:bbt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     BBta_0180 (gshB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: ABQ32477
RhizoBase: BBta_0180
UniProt: A5E8I3
Position
complement(186257..187198)
Genome map
AA seq 313 aa AA seqDB search
MKLNVAVQMDPIARINIRGDSTFALLLEAQRRGHGLSYYTPDKLSLRGEELYAPVQALAV
RDEIGDHFTLSEPKPTALASFDVVLLRQDPPFDLAYITSTHFLERIHPKTLVVNDPASVR
NAPEKLFVMNFPQLMPPTLISRDLDEINAFRAQHGAVVMKPLHGHGGAAVFRVMPQDMNF
GSLFDMFSVTFKEPWVIQRFLPEVKHGDKRIILVDGEFAGAVNRVPAADDLRSNMVRGGA
AQATELSPREREICDTLGPELRARGLLLVGIDVIDGNLTEINVTSPTGIRAISRLGGPDI
AARVWDVIEAKRR
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgaatgtcgccgtccagatggacccgatcgcgcgcatcaatatccgcggcgat
tcgacctttgcgctgctgctggaggcgcagcggcggggccatggcctctcctactacacg
cccgacaagctctcgctgcgcggcgaggagctgtacgcgccggtgcaggccttggccgtg
cgcgatgaaatcggcgatcatttcacgctaagcgagccgaagccgaccgccttggcctcc
ttcgacgtcgtgctattgcgacaggatccgccgttcgatctcgcctacatcacgtcgacg
catttcctggagcggatccatccgaaaacgctggtggtcaacgatcccgcgagcgtccgc
aacgcgccggaaaaactgttcgtgatgaacttcccgcagctgatgccgccgacgctgatc
tcgcgcgatctcgacgagatcaacgccttccgcgctcagcacggcgccgtggtgatgaag
ccgcttcacggccatggcggggcggccgtgttccgggtcatgccgcaggacatgaatttc
ggctcgctgttcgacatgttctcggtgaccttcaaggaaccctgggtgatccagcgcttc
cttcccgaggtgaagcatggcgacaagcgcatcatcctggtcgacggcgagttcgccggc
gccgtcaaccgggtcccggcggccgacgatctgcgctccaacatggttcgcggcggcgcc
gcgcaggccaccgagctcagcccgcgcgaacgcgagatctgcgatactctggggccggaa
ttgcgcgcccgcggcctgttgctggtcggcatcgacgtgatcgacggcaatctcaccgag
atcaacgtgacctcgccgaccggcatccgcgccatctcgcgcctgggcgggcccgacatc
gccgcccgcgtctgggacgtgatcgaggccaagcggcgttga

DBGET integrated database retrieval system