KEGG   Bradyrhizobium sp. BTAi1: BBta_0393Help
Entry
BBta_0393         CDS       T00528                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
bbt00020  Citrate cycle (TCA cycle)
bbt00640  Propanoate metabolism
bbt00660  C5-Branched dibasic acid metabolism
bbt01100  Metabolic pathways
bbt01110  Biosynthesis of secondary metabolites
bbt01120  Microbial metabolism in diverse environments
bbt01130  Biosynthesis of antibiotics
bbt01200  Carbon metabolism
Module
bbt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bbt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bbt00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BBta_0393 (sucC)
   00640 Propanoate metabolism
    BBta_0393 (sucC)
   00660 C5-Branched dibasic acid metabolism
    BBta_0393 (sucC)
Enzymes [BR:bbt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BBta_0393 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: ABQ32680
RhizoBase: BBta_0393
UniProt: A5E936
Position
393292..394488
Genome map
AA seq 398 aa AA seqDB search
MNIHEYQAKALLHEFGVPISKGVPVLRPEDSDAAAKALGGPVWVVKSQIHAGGRGKGKFK
EASAGDKGGVRLAKSIDEVNAFAKQMLGATLVTVQTGPDGKQVNRLYIEDGSDIDKEFYL
SLLVDRETSKVAFVVSTEGGVNIEDVAHSTPEKIITFSVDPATGVMPHHGRAVAKALKLS
GDLAKQAEKLTIQLYTAFVAKDMAMLEINPLVVTKQGQLRVLDAKVSFDSNALFKHPEVV
ALRDETEEDAKEIEASKYDLNYVALDGTIGCMVNGAGLAMATMDIIKLYGMEPANFLDVG
GGASKEKVAAAFKIITADPNVKGILVNIFGGIMKCDVIAEGVVAAVKEVGLKVPLVVRLE
GTNVDLGKKIISESGLNVLPADNLDDAAQKIVKAVKGG
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcacgaatatcaggccaaggcactgctgcacgagttcggcgtgccgatttcc
aagggcgtgccggtgctccgtccggaggactcggatgcggcggcgaaggcgctcggcggt
ccggtctgggtcgtgaagagccagatccacgccggcggccgtggcaagggcaagttcaag
gaggcctcggccggcgacaagggcggcgtccgcctcgccaagtcgattgacgaggtcaat
gcgttcgccaagcagatgctcggcgcaaccctcgtcaccgtgcagaccggccccgatggc
aagcaggtcaaccgcctctacatcgaggacggctcggatatcgacaaggaattctacctg
tcgctgctggtcgatcgcgagacctcgaaggtcgctttcgtggtgtcgaccgaaggcggc
gtcaacatcgaggacgttgctcacagcacgcctgagaagatcatcaccttctcagtcgat
ccggccaccggcgtgatgccgcatcacggtcgcgccgtcgccaaggcgctgaagctctcg
ggcgatctcgccaagcaggccgagaagctgaccatccagctctataccgccttcgtcgcc
aaggacatggcgatgctcgagatcaacccgctggtcgtcaccaagcagggccagctgcgt
gtgctcgacgccaaggtgtcgttcgactccaacgcgctgttcaagcaccccgaggtcgtg
gcgctgcgtgacgagaccgaggaagacgccaaggagatcgaggcctccaaatacgatctc
aactatgtcgcgctcgacggcaccatcggctgcatggtcaacggcgccggcctcgcgatg
gcgacgatggacatcatcaagctctacggcatggagccggccaacttcctcgacgtcggc
ggcggcgccagcaaggagaaggtcgcggcggcgttcaagatcatcaccgccgacccgaac
gtgaagggcatcctggtcaacatcttcggcggcatcatgaagtgcgatgtcatcgccgag
ggcgtcgtggccgcggtcaaggaagtcggcctgaaggtgccgctggtggtgcgcctcgaa
ggcaccaatgtcgatctcggcaagaagatcatcagcgagtccggtctgaacgtgctgccc
gccgacaatctcgacgacgccgcgcagaagatcgtcaaggccgtcaagggaggctga

DBGET integrated database retrieval system