KEGG   Bradyrhizobium sp. BTAi1: BBta_2656Help
Entry
BBta_2656         CDS       T00528                                 

Definition
(GenBank) phosphate butyryltransferase
  KO
K00634  phosphate butyryltransferase [EC:2.3.1.19]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
bbt00650  Butanoate metabolism
bbt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BBta_2656
Enzymes [BR:bbt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.19  phosphate butyryltransferase
     BBta_2656
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB MaoC_dehydratas MaoC_dehydrat_N OB_RNB
Motif
Other DBs
NCBI-ProteinID: ABQ34799
RhizoBase: BBta_2656
UniProt: A5EF55
Position
complement(2750656..2752080)
Genome map
AA seq 474 aa AA seqDB search
MTQTIRNKSWAELEVGDKAAIERTCAVQDLILFAHVSGNTNPMMLPDGSANHGSKEVIAP
SMWVGSLISAVLGNVMPGPGTLYRSQSLEFKKRVHVGDRLRITVTCCEKREAPVALFRAE
ITDQAGDLVCAGLAEIDAPTVSIETPVRELPALIVDHADHFAKLVDLAAQLPPLKTVIVC
PEDRNSLGGALLSTERGLIHPVLIGDPDRISAAAREIEADISGWALVPETDHRAAAARAV
AMVLAGDAHAVMKGAIHSDELLAAVVKKDGGLRTNGRISHVFALDVPTLDEILFISDAAI
NIAPDLMAKVDIVQNAIDLARACGLDRPRVGVLSAVETINPNIHSTLDAAVLSKMAERGQ
IKGGIVDGPLAMDNAIDMEAAKTKGIASLVAGHANVLIVPNLEAGNMLAKELTFIARAEA
AGLVIGARVPVMLTSRADNDRARLASCALAQLYNHWRREGRAFAGSAQAKAAAE
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgacccagaccatacgcaacaagagctgggcggagctggaggtcggcgacaaagccgcg
atcgaacggacatgcgcagtacaggacctgatcctgttcgcccatgtctccggcaacacc
aatccgatgatgctgccggatggtagcgccaaccatggttcgaaagaggtcattgcgcca
tcgatgtgggtcggatcgttgatctcggccgtacttggcaacgtcatgcccggtccgggc
acgctgtatcgctcgcaatcgcttgagttcaagaaacgtgtgcatgtcggcgaccgcctg
cgcatcaccgtgacctgctgcgagaagcgcgaggcgccggtcgcgttgtttcgcgccgag
atcaccgaccaggccggcgatctcgtctgcgcggggcttgccgagatcgatgcgccgaca
gtgtcgatcgagacgccggtgcgcgagctgccggcgctgatcgtcgatcatgccgatcat
ttcgccaagctggtcgatctcgctgcgcagctgccgccgctcaagaccgtcatcgtctgt
cctgaagaccgcaactcgctcggcggcgccctgctctcaaccgaacgtggcctgatccac
ccggtgctaatcggcgatcccgatcgcatctcggccgcggcgcgcgagatcgaggccgac
atcagcggctgggcgctggtgccggagactgaccaccgtgccgccgccgcgcgcgccgtg
gcgatggtgctggccggcgacgcccatgcggtgatgaagggggcgatccattccgacgag
ctgctggcggcggtggtgaagaaggatggcgggctgcgcaccaatggccggatcagccat
gtcttcgcgctcgacgtgccaacgctggacgagatcctgttcatttccgatgccgccatc
aacatcgcgcccgacctgatggcgaaggtcgacatcgtgcagaacgccatcgatctggcg
cgcgcctgcggactcgaccggccgcgcgtcggcgtgctgtccgcggtcgagaccatcaac
ccgaacattcactccacgctcgacgccgccgtactgtcgaagatggccgagcgcggccag
atcaagggcggtatcgtcgacggtccgctggcgatggacaatgccatcgacatggaagct
gcgaagaccaagggcatcgcctcgctggtcgccggccatgccaacgtgctgatcgtaccg
aacctcgaggccggcaacatgctggcgaaagagctgaccttcatcgcccgcgccgaggcc
gccgggctcgtgatcggcgcgcgcgtgccggtcatgctgaccagccgagcggacaacgac
cgagcccggctcgcctcctgcgccctcgcgcagctctacaatcactggcggcgcgagggc
cgcgcctttgccggctcggcgcaggcgaaggcggcggcggagtag

DBGET integrated database retrieval system