KEGG   Bradyrhizobium sp. BTAi1: BBta_3005Help
Entry
BBta_3005         CDS       T00528                                 

Definition
(GenBank) short chain enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
bbt00071  Fatty acid degradation
bbt00280  Valine, leucine and isoleucine degradation
bbt00281  Geraniol degradation
bbt00310  Lysine degradation
bbt00360  Phenylalanine metabolism
bbt00362  Benzoate degradation
bbt00380  Tryptophan metabolism
bbt00410  beta-Alanine metabolism
bbt00627  Aminobenzoate degradation
bbt00640  Propanoate metabolism
bbt00650  Butanoate metabolism
bbt00903  Limonene and pinene degradation
bbt00930  Caprolactam degradation
bbt01100  Metabolic pathways
bbt01110  Biosynthesis of secondary metabolites
bbt01120  Microbial metabolism in diverse environments
bbt01130  Biosynthesis of antibiotics
bbt01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bbt00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BBta_3005
   00650 Butanoate metabolism
    BBta_3005
  Lipid metabolism
   00071 Fatty acid degradation
    BBta_3005
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BBta_3005
   00310 Lysine degradation
    BBta_3005
   00360 Phenylalanine metabolism
    BBta_3005
   00380 Tryptophan metabolism
    BBta_3005
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BBta_3005
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BBta_3005
   00281 Geraniol degradation
    BBta_3005
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BBta_3005
   00627 Aminobenzoate degradation
    BBta_3005
   00930 Caprolactam degradation
    BBta_3005
Enzymes [BR:bbt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BBta_3005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ABQ35127
RhizoBase: BBta_3005
UniProt: A5EG33
Position
complement(3142039..3142818)
Genome map
AA seq 259 aa AA seqDB search
MSVYEHIIVEGKGAVGVITLNRPKMLNALSFGVFREIAAAVDDLEADDAIGCIVITGSEK
AFAAGADIKEMQPKSFIDMFSSDFTAIGGDRVARCRKPTIAAVAGYALGGGCELAMMCDF
IIAADTAKFGQPEITLGTIPGIGGTQRLTRAIGKAKAMDLCLTGRMMDAAEAERSGLVSR
VVAADRLMEETMAAAEKIASMSRPAAAMAKEAVNRAFETPLSEGMNVERNLFHATFALED
RAEGMAAFIEKRKPVNKNR
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtttacgagcacatcatcgtcgaaggcaaaggcgcggtcggggtcattaccttg
aacaggcccaagatgctcaatgcgctgtcattcggcgttttccgcgagattgccgcggcc
gtcgacgacctcgaggccgacgacgccatcggctgcatcgtgatcaccggcagtgagaag
gcttttgccgccggcgccgacatcaaggagatgcagcccaagagcttcatcgacatgttc
tcgagcgacttcaccgcgattggcggcgaccgggtcgcgcgctgccgcaagccgaccatc
gcggcggtggccggctacgccctcggcggcggctgtgagctcgcgatgatgtgcgacttc
atcatcgcggccgacaccgcgaaattcggccagccggaaatcacgctcggcaccatcccc
ggcatcggcggtacccagcgcctgacgcgcgccatcggcaaggccaaggcgatggacctc
tgcctgaccggccgcatgatggatgcggcggaagcggagcgctccggcctcgtcagccgc
gtcgtggcggcggaccggctgatggaagagacgatggccgcggccgagaagatcgcgtcg
atgtcgcgcccggcggcggccatggccaaggaagccgtgaaccgcgccttcgaaactccg
ctctcggaaggcatgaatgtcgagcgcaacctgtttcacgctaccttcgcgctcgaggat
cgcgccgaaggcatggccgcgttcatcgagaagcgcaagccggtcaacaagaaccgctga

DBGET integrated database retrieval system