KEGG   Bradyrhizobium sp. BTAi1: BBta_3349
Entry
BBta_3349         CDS       T00528                                 
Name
(GenBank) conjugation peptidase TraF, Serine peptidase, MEROPS family S26C
Organism
bbt  Bradyrhizobium sp. BTAi1
SSDB
Motif
Pfam: Peptidase_S26
Other DBs
NCBI-ProteinID: ABQ35450
RhizoBase: BBta_3349
UniProt: A5EH06
Position
3504553..3505068
AA seq 171 aa
MTTDAVLRLALIGVAAIAVSAVPQSSTVRFVWNLSASVPTGLYRLRPSGDRSIGEIVAVQ
PPQPIADFLASRGYLPRGVPMMKHVAALPGQVVCRHGLAILIDAVEVGQAQERDSRGRPL
PVWQGCRTLSKDEAFLMNTRSAISLDGRYFGVLPVSAIVGHAEPLWVGGEE
NT seq 516 nt   +upstreamnt  +downstreamnt
atgacgacagatgctgtgcttcgtcttgcgctcatcggagtggctgccatcgccgtgtcg
gccgtgccgcagtcgtcgaccgtccgctttgtctggaacctctctgcaagcgtcccgacg
ggcctctaccggctgcgccccagcggcgatcgctccattggcgagatcgttgcggtgcag
ccgccgcagccgatcgccgatttcctggcgagccgaggctacctgccgcgcggcgtaccg
atgatgaagcatgtcgcggcgctgcccgggcaggtcgtctgcaggcacggactcgcgatt
ctcatcgacgcggtcgaggtggggcaggcgcaagagcgtgatagccgggggcggccactg
ccggtgtggcagggctgccgaacgctcagcaaagatgaagcttttctgatgaacacgcgc
tcggcgatctccctcgatgggcgatatttcggcgtgctgccggtgtccgccatcgtcggt
cacgccgagccgctgtgggtgggtggggaggagtga

DBGET integrated database retrieval system