KEGG   Bradyrhizobium sp. BTAi1: BBta_3350
Entry
BBta_3350         CDS       T00528                                 
Name
(GenBank) putative Lytic transglycosylase
Organism
bbt  Bradyrhizobium sp. BTAi1
SSDB
Motif
Pfam: SLT Transglycosylas SLT_2
Other DBs
NCBI-ProteinID: ABQ35451
RhizoBase: BBta_3350
UniProt: A5EH07
Position
3505071..3505901
AA seq 276 aa
MHDGRRPFGARSIAQTSAGSFVAAASRVVATQVRRHGQSVIIAAVLAWSIVAGATAQASP
SSSRLHVVSTSSVDTFAGSVSEAAHRFDIPERWIYAVMRAESGGDRRARSSKGAVGLMQI
MPETWRDLRARYGLGADPFDPHDNVLAGAAYLRELHDRYGSPGFLAAYNAGPGRYERHLA
TGRPLPDETRAYVAKLSSAVGGVQAQRPVDVSRAAAFSLADLFAPRGSQRMADDHPSVTG
KRSVRSLRVARRGNLSSLLPRPHALFARHAGGNLWR
NT seq 831 nt   +upstreamnt  +downstreamnt
atgcacgacggtcgccggcccttcggtgctcgttcgatcgctcagacctccgctggctcg
ttcgtcgcggccgcttctcgcgtcgtcgctacgcaagtccggaggcacgggcagagcgtt
atcatcgctgcagtcctcgcatggtcgattgtcgccggcgcgacagcacaggcctccccg
tcgtcctcccgtctgcacgtcgtgagcacgtcctctgttgacacatttgcaggttctgtg
agcgaagctgcgcatcggttcgatattcccgagcgctggatctatgccgtcatgcgcgct
gaaagcggcggtgatcggcgggctcgctcgtcaaagggcgccgtcggcctgatgcagatc
atgccggagacctggcgcgatttgcgcgcccgctacggccttggggctgatcccttcgat
cctcacgacaacgttctggcgggcgcagcctatcttcgcgagctgcacgaccgttatgga
tcgcctgggttcctcgcagcctacaatgcgggtcccgggcggtatgaacgtcatctggca
acgggccggccgctgccggacgaaacccgagcctacgtcgcgaagctttcgtccgccgtc
ggcggtgtgcaagcccaacggcctgtcgatgtctcccgagcggcagcgttctcgcttgcg
gatttgttcgccccgcgcggttcgcaacgcatggccgacgatcatccgagtgtaactggc
aagcgctcggtcagatcattgcgtgtcgctcgccgcggcaatctttcgtcgcttctaccg
cggccgcatgcgttgtttgctcggcatgccggcggaaatctctggcgatga

DBGET integrated database retrieval system