KEGG   Bradyrhizobium sp. BTAi1: BBta_3356
Entry
BBta_3356         CDS       T00528                                 
Name
(GenBank) Putative Conjugal transfer protein traG
  KO
K03205  type IV secretion system protein VirD4 [EC:7.4.2.8]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
bbt03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bbt00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BBta_3356
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bbt02044]
    BBta_3356
Enzymes [BR:bbt01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     BBta_3356
Secretion system [BR:bbt02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   BBta_3356
SSDB
Motif
Pfam: T4SS-DNA_transf TraG-D_C TrwB_AAD_bind
Other DBs
NCBI-ProteinID: ABQ35456
RhizoBase: BBta_3356
UniProt: A5EH12
Position
3511046..3513046
AA seq 666 aa
MPGTRILWGQITAVVTIVLVTMWAATQWTAWRLGYQPQLGQPWFELAWGMPIYFPPSFLW
WWFAYDAYAPEVFAEGGLIAAFGGVASIAVAFGMSVWRAREPADVVTYGSARWATLKEIS
AAGLQGPDGVVLGRYADQYLRHDGPEHVLCFAPTRSGKGVGLVVPTLLTWSGSCIVHDIK
GENWQLTAGFRAPHGRVLLFDPTNARSAAYNPLLEVRRGEWEVRDVQNVADVLVDPEGSL
ERRNHWEKTSHALLVGAILHVLYAEADKTLAGVANFLSDPKRPIDVTLRAMMTTAHLGDA
GPHPVIASAARELLNKSENERSGVLSTAMSFLGLYRDPVVAQVTRRCDWRIRDLVAGEHP
TTLYLVVPPSDISRTKPLVRLILNQIGRRLTEDLQAHGRRHRLLLMLDEFPALGRLDFFE
SALAFMAGYGLKSFLIAQSLNQIEKAYGANNAILDNCHVRVSFATNDERTAKRVSDALGT
ATEMRAMKNYAGHRLSPWLGHLMVSRQETARPLLTPGEVMQLPADDELVLVSGVPPIRGK
KARYFADPRLVDRVLPPPNPVLTDQDGDAAADDWSRLPPIARTIAAKEQGRPAALDAAGD
AANAGIRREPELPEHEEIVPEPSRPAQEFNFDREVDDEMVRNSVLRDQLRGLPRQAALDP
DDGLGL
NT seq 2001 nt   +upstreamnt  +downstreamnt
atgcctggcacgcgaatcctctgggggcagatcacagcggtcgtcacgatcgtgcttgtc
acgatgtgggccgcgacgcagtggacggcgtggcggctggggtatcaaccgcagcttggg
cagccctggttcgagctggcgtggggtatgccgatttatttcccgccttcgtttttatgg
tggtggtttgcgtatgacgcctatgcgcccgaggtgttcgccgagggaggtctgattgcg
gcgttcggcggtgtggcctcgatcgcggttgcgttcggcatgtcggtgtggcgggcgcgt
gagcccgccgatgtcgtcacctacgggtccgcgcgatgggcgacgctgaaggagatctcc
gctgccgggctgcaggggccggacggcgtggtgctgggacggtacgcggatcagtacctt
cgtcatgacggtccggagcatgtgctgtgtttcgcgccgacccgctcgggcaagggcgtt
ggcctggtagtgccgaccctgctgacgtggtcgggtagttgcatcgtgcacgacatcaag
ggcgagaactggcaactgacggcgggctttcgagcgccgcatggccgggtgctgctgttc
gatccgaccaatgcgcgatcggcggcctacaatccgctgctcgaggtgaggcgaggggag
tgggaggtccgcgacgtccagaatgtcgccgacgtcctggtcgatcctgaagggtcgctg
gagcggcgcaatcattgggagaagacgagccacgcactactggtcggggccattctccat
gtgctttacgcggaagctgacaagacgctggcgggggtcgccaacttcctctccgatcca
aagcggccgatcgatgtcactctgcgcgcgatgatgaccacggcgcatctgggggacgcc
gggccgcaccctgtgatcgcatccgccgcccgcgagctcctgaacaagagcgaaaacgaa
cgctcgggcgtgctctcgaccgcgatgtcgtttctcggtttgtatcgagatccggtggta
gcgcaggtgacgcgccgttgcgactggcggatccgtgatctcgtcgctggcgagcatccg
accacgctctatctcgtggtgccgccctccgacatcagccggaccaagccgctggtgcgg
ctgatcctcaaccagatcggccgccgactgaccgaggatctgcaggcccacgggcggcgc
caccggctgcttctgatgctcgacgaattcccggcactcggccggctcgacttcttcgag
tccgcgctcgccttcatggctggttacggcctcaagagcttcttgatcgcgcaatcgctc
aatcagatcgagaaggcctacggggccaataacgccatcctcgacaattgtcatgtgcgg
gtgtcgtttgcgaccaatgacgagcgtaccgccaagcgtgtgtcggacgcgctggggacc
gccaccgagatgcgggcgatgaagaactatgccggccatcgactgagcccttggctggga
catctcatggtgtcacgccaggagacggcgcgtcccttgctcacgccgggagaggtgatg
cagctgccggctgatgatgagttggtgctggtctccggtgttccgccgatccgcggcaag
aaggcccggtatttcgcagatccgcggctggtcgatcgggtgttgccacctcccaatccg
gttttgacggatcaggacggcgacgcagcagcggatgattggagcaggctgccgccgatc
gctcggactatcgcagcaaaagagcaggggaggccggctgcgctggatgcagccggtgac
gccgcgaatgccgggatccggagggagcccgagcttcccgagcatgaggagatcgtgccg
gagccgtcgcggcccgcgcaggagttcaactttgacagagaagtggatgacgagatggtg
cgcaacagcgtgctccgtgaccagcttcgcggcttgccgcgccaggcggcgctggacccg
gacgatggccttggtctgtag

DBGET integrated database retrieval system