KEGG   Bradyrhizobium sp. BTAi1: BBta_3364
Entry
BBta_3364         CDS       T00528                                 
Symbol
trbB
Name
(GenBank) conjugal transfer protein trbB
  KO
K20527  type IV secretion system protein TrbB [EC:7.4.2.8]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
bbt02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bbt00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BBta_3364 (trbB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bbt02044]
    BBta_3364 (trbB)
Enzymes [BR:bbt01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     BBta_3364 (trbB)
Secretion system [BR:bbt02044]
 Type IV secretion system
  Trb secretion system protein
   BBta_3364 (trbB)
SSDB
Motif
Pfam: T2SSE Zeta_toxin AAA_16 FtsK_SpoIIIE AAA_28 MMR_HSR1 TrwB_AAD_bind bpMoxR AAA_7 AAA_25 ABC_ATPase GTP_EFTU CbiA AAA_19 DEAD IstB_IS21 Mg_chelatase CLP1_P DUF815 Septin
Other DBs
NCBI-ProteinID: ABQ35463
RhizoBase: BBta_3364
UniProt: A5EH19
Position
3521448..3522428
AA seq 326 aa
MAVHSWRTEASSRGARMLRTALGPAIAGWLDDPAVIEVMLNPDGRLWVDRLASGLTATGE
TLSPADGERIVRLVAHHVGGEVHAGAPRVSAELPETGERFEGLLPPVVIAPAFAIRKPAV
AVFTLADYVASGIVTREQADLLRIAMAARSNILVAGGTSTGKTTLTNALLAEVARTADRV
VLIEDTRELQCAAPNLVSLRTRDGVATLTDLVRSALRLRPDRIPIGEVRGPEALDLLKAW
GTGHPGGIGTIHAGSAIGALRRLEQLIQEAVVTVPRALIAETIQLIAVLAGRGADRRLVE
LAHVDGLNARGDYQLSQLSLSQGEQP
NT seq 981 nt   +upstreamnt  +downstreamnt
atggcggttcattcatggcggaccgaggcgagctcgcgcggcgcgcggatgttgcgcacg
gcgctggggcctgccatcgcgggctggctcgatgatcccgctgtcatcgaggtgatgctc
aacccggatggccggctctgggtcgatcgtctcgcttcgggtctgactgcaacgggtgag
acgctctcgcccgccgatggcgagcgcatcgtgcgtctggtcgcgcatcatgtcggcggc
gaggttcatgccggtgcgccgcgcgtctcggccgagctgccggagaccggtgagcgcttc
gaaggtctgctgccgcccgtcgtgatcgcgccggcctttgccatccgcaagcccgcggtc
gccgtgttcacgctcgcggattacgtcgcgtccgggatcgttacgcgagagcaggccgac
ctgttgcgaatagctatggccgcgcgcagcaacatcctcgtcgcagggggcacctcgacc
ggcaagaccacgctgacgaatgcgctgttggcggaagttgcaagaacggccgatcgggtg
gtgctgatcgaggatacgcgcgagctgcaatgcgcagcgcccaatctggtgtcgcttcgg
accagggacggtgttgccaccctgacggacctcgtgcggtccgcgttgcggttgcgaccc
gataggatcccgatcggcgaagttcgcgggcccgaggctctggatctgctgaaggcttgg
ggcaccggtcatcccggcggcatcggcaccatccatgcgggctccgcgatcggcgcgctc
aggcgcctggagcaattgatccaggaagccgtggtcaccgtgccgcgtgctctgatcgcc
gagaccatccagctgatcgccgtgctcgccggccgcggcgcagaccggcgcctcgtcgag
ctcgcccacgtcgatgggctgaatgcccgcggcgactatcagcttagccagctctcgctc
tcgcaaggagaacagccatga

DBGET integrated database retrieval system