KEGG   Bradyrhizobium sp. BTAi1: BBta_3365
Entry
BBta_3365         CDS       T00528                                 
Symbol
trbC
Name
(GenBank) conjugal transfer protein trbC
  KO
K20528  type IV secretion system protein TrbC
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
bbt02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bbt00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BBta_3365 (trbC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bbt02044]
    BBta_3365 (trbC)
Secretion system [BR:bbt02044]
 Type IV secretion system
  Trb secretion system protein
   BBta_3365 (trbC)
SSDB
Motif
Pfam: TrbC
Other DBs
NCBI-ProteinID: ABQ35464
RhizoBase: BBta_3365
UniProt: A5EH20
Position
3522425..3522754
AA seq 109 aa
MKQRSGLSAFGAVASSAVTLASFAMSPARAAGSNMPWEQPLNQILLSVQGPVAKILAVII
IISTGLTLAFGDTSGGFRRLIQIVFGLSIAFAASSFFLAFFSFGGGAVI
NT seq 330 nt   +upstreamnt  +downstreamnt
atgaagcaacgctcaggtctttccgcttttggggcggtcgcgtcttcggctgtgactttg
gcgagctttgcgatgagcccggcccgcgccgcgggctccaacatgccgtgggagcagccg
ctcaatcagatcctgctgtcggtccagggacctgtggcgaaaatcctggcagtcatcatc
atcatcagcactggcctgacgctcgccttcggcgacacgtcgggaggattccgccgcctg
atccagatcgtcttcgggctctcgatcgcctttgcggcctcgagcttcttcctggcgttc
ttctcgttcggtggcggggcagtgatctga

DBGET integrated database retrieval system