KEGG   Bradyrhizobium sp. BTAi1: BBta_3366
Entry
BBta_3366         CDS       T00528                                 
Symbol
trbD
Name
(GenBank) Conjugal transfer protein trbD
  KO
K20529  type IV secretion system protein TrbD
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
bbt02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bbt00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BBta_3366 (trbD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bbt02044]
    BBta_3366 (trbD)
Secretion system [BR:bbt02044]
 Type IV secretion system
  Trb secretion system protein
   BBta_3366 (trbD)
SSDB
Motif
Pfam: VirB3
Other DBs
NCBI-ProteinID: ABQ35465
RhizoBase: BBta_3366
UniProt: A5EH21
Position
3522754..3523035
AA seq 93 aa
MDAFGQADQSLPGFAITVRRSLTEPILLGGAPRAIAILNGTLAAALGLGLRLWIAGLLFW
VIGHGAAVWAAKRDPDFVEVVRRHLRIPGHLNV
NT seq 282 nt   +upstreamnt  +downstreamnt
atggatgcgtttggccaagccgatcagtcgcttcccggcttcgcgatcactgtccgccgc
tctctgaccgagcccatcctgctcggcggtgcgccacgcgccatcgcgatcctcaacggt
acgctcgccgcggcgcttggcttggggctgcggctctggattgcggggcttctgttctgg
gtgatcggccatggcgcggcagtgtgggccgccaaacgcgatccggacttcgtcgaggtc
gtgcgccggcacctgcgcattcccggtcatctcaatgtgtga

DBGET integrated database retrieval system