KEGG   Bradyrhizobium sp. BTAi1: BBta_3367
Entry
BBta_3367         CDS       T00528                                 
Symbol
trbE
Name
(GenBank) conjugal transfer protein trbE
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
bbt02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bbt00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BBta_3367 (trbE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bbt02044]
    BBta_3367 (trbE)
Enzymes [BR:bbt01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     BBta_3367 (trbE)
Secretion system [BR:bbt02044]
 Type IV secretion system
  Trb secretion system protein
   BBta_3367 (trbE)
SSDB
Motif
Pfam: P-loop_TraG CagE_TrbE_VirB AAA_22 AAA_10 TraG-D_C ABC_tran AAA_16 AAA_29 HerA_C DUF87 FtsK_SpoIIIE
Other DBs
NCBI-ProteinID: ABQ35466
RhizoBase: BBta_3367
UniProt: A5EH22
Position
3523046..3525490
AA seq 814 aa
MMNLREYRNSNARLSDYLPWAALVDHGIVLNKDGSLQRSARFRGPDLDSAVPAELVAVAG
RLNNALRRLGSGWAIFVEAFRYPSQLYPASQFPDPASALVEAERRAQFQAQGAHFESNYF
LTFVYLPPSEDASRAERWLYEGRAQGEGGDAQEILRGFADRTDRILQLLDGFMPECRWLD
DEETLTYLHATISTKLQRVRVPEIPVHLDALLADRPLTGGLEPRLGDAHLRVLTIVGFPT
ATTPGILDELNALAFPYRWSTRAIMLDKSDATRLLTRIRRQWFAKRKSIAALLKEVVTNE
AAALVDTDAHNKALDADAALQDLGSDLIGEALVTATITVWDEDPRIADERLRLAEKVIQG
RDFTCMVETVNAVEAWLGSLPGHVYANVRQPPVSTLNIAHMIPLSAVWAGPQRDQHLGAP
PLFVARTEGATPFRFSLHVGDVGHTLVVGPTGAGKSVLLALMAMQFRRYPGSQVFAFDFG
GSIRAAALAMGGDWHDLGGALSDEASEAVALQPLAAIEDATERGWAADWIAAILAREQIS
ITPEVRDHLWSALTSLASAPVSERTLTGLSILLQSNVLKRALQPFCLGGGPYGRLLDADA
ERLGGASVQAFETEGLIGTAAAPAVLAYLFHRIEGQLDGRPTLLIVDEGWLALDDDGFAG
QLREWLKTLRKKNASVVFATQSLSDIDGSKIAPAIIESCPTRLLLPNERALEPQITAIYR
RFGLNDRQIEILARATPKRDYYCQSRRGNRLFELGLGEVALALIAASSKTDQADMTRVLA
EHGQDGFLAGWLTHRGVSWAIDLIPHLNGREVLA
NT seq 2445 nt   +upstreamnt  +downstreamnt
atgatgaacttgcgcgaatatcgcaacagcaatgcgcgcctgtccgattatctgccatgg
gccgctctggtcgatcatggaatcgtcctcaacaaggatggctcgctgcagcggagcgcg
cgctttcgcgggccggatcttgactcggcggtaccggccgagctcgtggctgtggccggt
cggctcaataatgccctgcggaggcttggctctggatgggccatcttcgtcgaggcgttc
aggtatccgtcgcagctctatcccgcgagccaattccctgatccggcctcggcgctggta
gaggccgagcgccgggcgcagttccaggcgcagggcgcgcatttcgagtcgaactatttc
ctgaccttcgtctatctgccgccgtcagaagatgcctcacgcgccgagcgctggctgtat
gagggacgcgcgcaaggcgagggcggtgatgcccaggaaatcctgcgtggtttcgccgac
cgcacggatcgcatcctgcagctgctcgacggcttcatgccggagtgtcgctggctcgac
gacgaggagacgctgacctatctgcacgcgaccatctcgaccaagctgcagcgtgtccgc
gtccccgaaatccctgttcatctcgatgcgctgctggccgatcgaccgctgacaggaggc
ctcgagccgcggctgggcgacgctcacctgcgggtactgacgatcgtcggtttcccgacc
gccaccacgccaggaatcctcgacgagctcaatgcgctggcgtttccctatcgctggtcg
acccgggcgatcatgctcgacaagagcgacgcgaccaggctgctgaccaggatccggcgg
cagtggttcgccaagcgcaagtcgattgccgcgctcctcaaggaagtcgtgaccaacgag
gccgccgcgctggtcgacaccgatgcccacaataaggcgctcgacgccgatgcggcgctg
caggatctcggctccgatctgatcggggaggccttggtcaccgcgaccatcacggtctgg
gatgaggatccgcgcattgccgatgagcgattgcggctcgccgagaaggtgatccagggc
cgcgactttacctgcatggtcgagacggtcaatgcggtcgaggcttggcttgggtcgctg
cctggccacgtctacgccaatgtgcgccagccgccggtctcgaccctgaacattgcgcat
atgatcccgctatcggcggtctgggccggcccgcagcgcgatcagcatctcggtgcgccg
ccgctgttcgtggcgcgcaccgagggcgcgacgccgttccggttctcgctgcacgtcggc
gacgtcgggcacacgctcgtggtgggtccgaccggggccggcaagtcggtgctgctggcg
ttgatggcgatgcagttccgccgctatcccggctcccaggtgttcgccttcgatttcggc
ggctcgatccgcgcggccgcgctcgccatgggcggcgactggcatgatctcggcggggcc
ttgtcggacgaggcatcggaagcggtcgcgctgcagccgcttgcggcgattgaggatgcg
acggagcgcggctgggcggccgactggatcgcggccatccttgcgcgcgagcagatcagc
atcacgcccgaggtgcgggaccatctgtggtcggcgctgacatcgctggcgtcggcgccg
gtgtctgagcggacactgacgggcctctccatcctgctgcagtccaatgtgctgaagcgg
gcgttgcagccattttgtctcggtggcggcccttacggccggctgctcgatgccgacgcc
gagcggctcggtggtgcgtccgttcaggcgttcgagaccgaaggtctaatcggcacggcg
gcagcgcctgccgtgctcgcctatctctttcaccgcatcgaaggccagctcgacggccgc
ccgacgcttctgatcgtcgacgaaggatggctcgcgctcgacgacgacggctttgccggc
cagctccgggagtggctgaagacgctgcgcaagaagaacgcgtctgtcgtcttcgccacg
cagtcgctgtccgacatcgatggatcaaagattgcccccgccatcatcgagagctgcccc
acccggttgttgctgccgaacgagcgcgcgctcgagccgcagatcacagccatctatcga
cggttcggcctgaacgaccgccagatcgagatcctggcccgggccacaccgaagcgggac
tattactgccagtcgcgccgcggcaaccgtctctttgagctcggtctcggcgaggtcgcg
ctggcgctgattgcggcgtcctcaaagaccgaccaggccgacatgacgcgcgtgcttgcc
gaacacggacaggatggcttcctagccggctggctcacccatcgcggcgtgtcctgggcg
atcgacctcattccccatctgaatggccgggaagtcctcgcatga

DBGET integrated database retrieval system