KEGG   Bradyrhizobium sp. BTAi1: BBta_3372Help
Entry
BBta_3372         CDS       T00528                                 

Definition
(GenBank) putative conjugal transfer protein trbG
  KO
K20532  type IV secretion system protein TrbG
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
bbt02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bbt00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BBta_3372
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bbt02044]
    BBta_3372
Secretion system [BR:bbt02044]
 Type IV secretion system
  Trb secretion system protein
   BBta_3372
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CagX
Motif
Other DBs
NCBI-ProteinID: ABQ35471
RhizoBase: BBta_3372
UniProt: A5EH27
Position
3528441..3529388
Genome map
AA seq 315 aa AA seqDB search
MNGRILTATALSFLLSGCATSKPPEIRYDAEVPPLPAAPVTVDDRPRALHVPPPWKVTFG
GKAGTKEEGDPVDRIEMANDAARVEPRKQGYYNAAQIYAYSPGAIYQVYAAPGQITDIAL
EPGEQLTGSGPVAAGDTVRWVVGDTESGAGDTRRVHILVKPTRAGIETNLVVNTDRRTYL
IELRAREKPYMPAVAWYYPEANAAGRAIVALTPVLPDPAQRRFRYRIEGDDPPWRPVIVY
DDGRKVYVEFSPGIVQGEMPPLFVTGSDGKPEIVNYRAHGNVLIVDRLFAAAELRLGGDP
QQTVRIVRTDGQVRP
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaacggccgcatcctcaccgcgacggcgctttcgtttctgctgagcggctgcgccacg
tcgaagccgccggagatccgttatgacgccgaggtgccaccgttaccggcagcgcctgtc
acggttgatgacaggccgcgggcgctccatgtgccgccgccatggaaggtgaccttcggt
ggtaaggctggcacgaaggaggagggcgatcctgtcgatcggatcgaaatggccaacgat
gcggcacgcgtcgaaccgcgcaagcagggttattacaacgcggcgcagatctatgcttat
agtccaggagcgatctatcaggtctacgcagcaccggggcaaattaccgatatcgcgctc
gagccaggtgaacagctcacgggatcaggcccggtcgcggccggcgacaccgtgcggtgg
gtggtcggcgataccgagagcggcgcgggcgatacgcgtcgcgtccacatcctggtcaag
ccgacgcgcgcaggcatcgagaccaatctcgtcgtcaacaccgaccgccgcacctatctg
attgagctgcgcgcccgcgagaagccatacatgccggccgtggcctggtactatccggaa
gcgaatgctgcgggcagggcaatcgtagccctgacgcccgtcctgccagatcccgcgcag
cgccgcttccgctatcgcatcgagggcgatgatccgccatggcgaccggtgatcgtctat
gacgacggccgcaaggtctatgttgaattctctcccggcatcgtccaaggcgagatgccg
ccattgttcgtgaccggatccgacggcaagccggagatcgtcaactatcgagctcatggc
aacgtcttgatcgtggatcggctgttcgcggcagccgagctgcgcctgggcggcgacccg
cagcagaccgtgcggatcgttcgcaccgacggacaggttcggccatga

DBGET integrated database retrieval system