KEGG   Bradyrhizobium sp. BTAi1: BBta_3373
Entry
BBta_3373         CDS       T00528                                 
Name
(GenBank) putative conjugal transfer protein trbI
  KO
K20533  type IV secretion system protein TrbI
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
bbt02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bbt00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BBta_3373
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bbt02044]
    BBta_3373
Secretion system [BR:bbt02044]
 Type IV secretion system
  Trb secretion system protein
   BBta_3373
SSDB
Motif
Pfam: TrbI
Other DBs
NCBI-ProteinID: ABQ35472
RhizoBase: BBta_3373
UniProt: A5EH28
Position
3529385..3530587
AA seq 400 aa
MSAEGKGTSARPNDPEPAADPAASFRLGGEPPRITRLSRKILASGSAVALALIAGAVLWA
LQSPGTRKPAAQSELASSGHREVADGVSSLPRDYTQIATDVPVLGPPLPGDLGRPILASQ
GQMPGSSQDQEQQRREQEQEAARVSRLFATTTTTATQPSPNVAQGVGLGGVPAATDDAFA
QNGQDRKLAFVSGPVDRRTTSPDRLTRPASPYVVQAGTVIPGALITGIRSDLPGQIEAQV
TENVFDTPSGRFLLVPQGARLIGVYDSQVAAGQSRVLLVWTRLVMPNGRSIVLERQPGAD
AGGYAGLSDEVDNHWKQIAGAALLSTLLSMGSGVNAGANPNTNNAAIIQALRQGFGNAVS
QTGQQLVRQQMDIQPTLTVRPGFPVRVIVNRDLVLEPYQG
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgagcgcggagggcaaaggcacgagcgcacggccgaacgatccggagccggctgccgat
cctgcggcgtccttccgccttggcggagagccgccacggatcactcggttgtcgcgcaag
attctggccagcggcagcgccgtggcgctcgcgctgatcgcaggcgccgttctgtgggcg
ctgcaaagccctggcacgcgcaagccggcggcccaatccgagctcgccagttcggggcat
cgcgaggtcgcagatggcgtctccagcctgccgcgtgactacacgcaaattgccacggat
gtcccggtgctcgggccgccgttgcccggcgatctcggacggccaatccttgcctcccag
gggcaaatgccgggttcaagtcaagaccaggagcagcagcgccgcgaacaggagcaggag
gccgcgcgcgtcagccggctgtttgcgacgaccacgacgacggcaacgcaaccctcgcca
aatgtggctcagggcgtcgggcttggaggggtgccggcggccacggacgacgccttcgcg
cagaacggccaggaccgaaaactcgccttcgtgagcgggccggtggatcggcgcaccacg
agccctgatcgcctcacgcggccggcttcgccttacgtcgtgcaggctggcacggtcatt
ccgggcgccctgatcactggcattcgctccgacctgccgggacaaatcgaggcgcaagtc
accgaaaatgtcttcgatacaccttcgggacgattcctgttggtgccccagggagcacgg
ctgatcggcgtctacgacagccaggtagcggctggacaatcccgcgtgctcttggtctgg
acccgtctggtcatgcccaacggccgctcgatcgtgctcgagcggcagccgggcgcggat
gccggcggctatgcggggctgtcggacgaggtcgacaatcattggaagcagattgcgggc
gcagctctgctctcgacgctcctctccatgggcagcggggtgaatgccggcgccaatccg
aataccaacaacgccgcgatcatccaggcccttcgtcagggcttcggcaatgccgtgagt
cagaccggtcagcagctcgtacgtcagcagatggacatccaaccgacattgacagtcagg
ccagggtttccggtacgggtgatcgtcaatcgggatctcgtgcttgagccgtatcaagga
tga

DBGET integrated database retrieval system