KEGG   Bradyrhizobium sp. BTAi1: BBta_3575Help
Entry
BBta_3575         CDS       T00528                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA acetyltransferase with thiolase domain
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
bbt00071  Fatty acid degradation
bbt00072  Synthesis and degradation of ketone bodies
bbt00280  Valine, leucine and isoleucine degradation
bbt00310  Lysine degradation
bbt00362  Benzoate degradation
bbt00380  Tryptophan metabolism
bbt00620  Pyruvate metabolism
bbt00630  Glyoxylate and dicarboxylate metabolism
bbt00640  Propanoate metabolism
bbt00650  Butanoate metabolism
bbt00900  Terpenoid backbone biosynthesis
bbt01100  Metabolic pathways
bbt01110  Biosynthesis of secondary metabolites
bbt01120  Microbial metabolism in diverse environments
bbt01130  Biosynthesis of antibiotics
bbt01200  Carbon metabolism
bbt01212  Fatty acid metabolism
bbt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bbt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BBta_3575 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    BBta_3575 (atoB)
   00640 Propanoate metabolism
    BBta_3575 (atoB)
   00650 Butanoate metabolism
    BBta_3575 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BBta_3575 (atoB)
   00072 Synthesis and degradation of ketone bodies
    BBta_3575 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BBta_3575 (atoB)
   00310 Lysine degradation
    BBta_3575 (atoB)
   00380 Tryptophan metabolism
    BBta_3575 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BBta_3575 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BBta_3575 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BBta_3575 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bbt04147]
    BBta_3575 (atoB)
Enzymes [BR:bbt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BBta_3575 (atoB)
Exosome [BR:bbt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BBta_3575 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C PUF
Motif
Other DBs
NCBI-ProteinID: ABQ35665
RhizoBase: BBta_3575
UniProt: A5EHM1
Position
complement(3734212..3735399)
Genome map
AA seq 395 aa AA seqDB search
MASSDPVVILSAARTPLGRFIGELSPLSAHKLGAHVIRAAIERATIAPDAVQEIFMGNVL
PAGQGQAPARQAARGAGLPDATGATTINKVCGSGMKATMLAHDIITAGSAEIVVSGGMES
MSNAPYLLTKARSGYRAGHDRILDHMLLDGLEDAYESGRSMGDFGEATAEAYQFSRADQD
AYAIETLTRARQAVESGAFKAEIAPITLTEKAGPRLIANDEHPLKVDPAKIPTLKPAFRK
DGTITPAASSANADGAAALVLATRSRAVRDGLPVIAEIKGHATHSQEPQWFTTAPIPAIR
KLLDKVGWRVEDVDLFEINEAFAVVAMAAQRDLGIPRDRLNVNGGACALGHPIGATGARL
IVTLLHAMEARGLKRGVASLCIGGGEATAIAVERP
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgtccgatcccgtcgtgatcctgtctgccgctcgtaccccgctcggccgcttc
atcggcgagttgtccccgctgagcgcgcacaagctcggtgcgcatgtgatccgagccgcg
atcgaacgcgcgaccattgcgcccgacgcggtccaggagatcttcatgggcaacgtcctg
cccgccggtcagggccaggctccagcgcgacaggcggcgcgcggcgccggcctgccggat
gcgacgggcgctacgacgatcaacaaggtctgcggctccggcatgaaggcgactatgctg
gcgcacgacatcatcacggccggctcggccgagatcgtcgtgtccggcggcatggagagc
atgagcaatgctccctatctgctgaccaaggcccgcagcggctatcgcgcggggcacgat
cgcatcctcgaccacatgctgctggacggacttgaggacgcctacgagtccgggcgctcg
atgggcgatttcggcgaggcgacggcagaagcctaccagttcagccgcgccgatcaggat
gcctacgcgatcgagaccctgacacgagcgcgccaggccgtcgagagcggcgcattcaag
gccgagatcgcaccgatcaccctgacggagaaagccggccctcgcctgatcgccaatgac
gaacacccgctcaaggtcgatcccgcgaaaatcccgacgctgaagccggcgttccgcaag
gacggcacgatcacgccagcggcctcctcggccaatgccgacggcgccgcagcgctcgtg
ctcgcgacccgatcccgcgccgtgcgcgacggactgcctgtcatcgccgagatcaagggt
catgcgacgcacagccaggagccgcaatggttcacgacggcgccgatccccgcgatccgg
aagctgctcgacaaggtcggctggcgcgtcgaggacgtcgatctgttcgaaatcaacgag
gcctttgccgtcgtcgcgatggcagcgcagcgcgatctcggcatcccccgcgaccgtctg
aacgtcaatggcggcgcctgcgcgctcggccacccgatcggcgccaccggcgcacgcctg
atcgtgacgctgctgcatgcgatggaggcccgcggcctcaagcgcggcgtggcatcgctg
tgcatcggcggcggtgaggcgaccgccatcgcggtggagcgtccgtga

DBGET integrated database retrieval system