KEGG   Bradyrhizobium sp. BTAi1: BBta_3606
Entry
BBta_3606         CDS       T00528                                 
Name
(GenBank) putative exported protein of unknown function
Organism
bbt  Bradyrhizobium sp. BTAi1
SSDB
Motif
Pfam: Legionella_OMP YabA Cep57_CLD_2 TSC22 DUF2046 ZapB TMF_TATA_bd NRBF2
Other DBs
NCBI-ProteinID: ABQ35695
RhizoBase: BBta_3606
UniProt: A5EHQ1
Position
3773861..3775153
AA seq 430 aa
MSTALRRNVSILSLVLASASASAAEVEDLNARLARLERENAAMRMENAALRENKRLREEN
GRLRSAENSEPMRSASSNGAAGSGRLAADRSAAPASLRPGLEARDPYQSYASADGPGAYK
APARPASGVLKIWGEGGAIWSGGDRFFQDAGTALAAFPNTTVSPPLDLTPKVGWEAATGF
DYLIAGSPWHVSGQLRYGQSGQASAQILSSGRLDLGRGRVITASDTFDATYQESRWLADI
AIGRDVFGTGPGALQVKGGLRLLDFETRATNSDLLRQNASIVDVGNVVFTNVDAAQANDG
ANRNSFLGAGPRVGVEGSIPFAGRWSLDYLSDVAVLFGVQRNVVNSRSQSSASVPVLAQP
GTSFTVSTERNTALFNADLQFGLSYWINENVKLGGSYRVDALINTQDTTFTPNRFTHGPR
LTVTGQFDAR
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgagcaccgcgcttcgtcgtaacgtctcgatcctcagcctcgtgcttgcatccgcaagc
gcctcggctgcggaggtcgaggatctgaatgcccgactggcaaggctggagcgggagaat
gcagcgatgcggatggagaacgccgcgctgcgcgagaacaagcggctgcgtgaggagaac
ggccggctgcgctcggctgagaactccgagccgatgcgctcggcctcctcgaatggtgca
gccggctcaggacggctggccgcagaccgaagcgcggcgccagcttctctgcgcccggga
ctggaagccagagatccctatcagagctatgcatcggcagatggtcccggcgcctacaag
gcaccggctcgtccggccagcggcgtgctgaagatctggggggaaggcggcgccatctgg
agcggcggcgaccggttcttccaggatgcgggcacggcgctcgctgcatttcccaacacg
accgtgtccccgccgctcgatctgacgcccaaggtcggttgggaggccgccaccggcttc
gactatctgatcgctggctcgccatggcacgtcagcggccagctccgctatggtcagagc
ggccaggccagcgcgcaaatcctgtcgtccggacggcttgatcttggacggggccgcgtc
atcacggcctctgatacgttcgatgcgacctatcaggaatcgcgctggctggccgatatc
gccatcgggcgcgacgtgttcggaaccgggccgggggcgcttcaggtcaagggtggactg
cggctgctcgactttgaaacccgtgcgaccaactccgatctgctgcgacagaatgcgagc
atcgtcgatgtcggcaacgtggtcttcaccaacgtcgatgccgcacaggcgaacgacggc
gcgaatcgcaacagctttctcggcgccggcccgcgtgtcggcgtggaaggctcgatcccg
ttcgccggccgctggtcgctggactatctcagcgacgttgccgtgctgttcggcgttcag
cgcaacgtcgtcaacagcaggtcccagtcgtccgccagcgtgccggtactggcgcaaccc
ggcaccagcttcaccgtctccacggagcgcaacaccgcgctgttcaatgccgatctgcag
ttcggcctgtcatattggatcaacgagaacgtcaagctcggcggaagctaccgggtcgat
gccttgatcaacacgcaggatacgacgttcacgccgaaccgcttcacgcatggcccgcgg
ctgacggtgacgggccagttcgatgcgcgatga

DBGET integrated database retrieval system