KEGG   Bradyrhizobium sp. BTAi1: BBta_4100Help
Entry
BBta_4100         CDS       T00528                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
bbt00450  Selenocompound metabolism
bbt00970  Aminoacyl-tRNA biosynthesis
bbt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BBta_4100
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BBta_4100
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bbt01007]
    BBta_4100
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bbt03016]
    BBta_4100
Enzymes [BR:bbt01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BBta_4100
Amino acid related enzymes [BR:bbt01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BBta_4100
Transfer RNA biogenesis [BR:bbt03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BBta_4100
 Prokaryotic type
   Other AARSs
    BBta_4100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ABQ36166
RhizoBase: BBta_4100
UniProt: A5EJ22
Position
complement(4299778..4301946)
Genome map
AA seq 722 aa AA seqDB search
MAKASKTTVKKGKPASAAKNKAAAKSPAKAKSPVKAGAKTKAKDKDAKDKATKAKAAKGK
AAKTAPAKAKTKAKSKAPKAKATKVVAKKAVKAPAKKVVAKPAATAAKKPAATSKAAPAK
KPAASRQPAAPKAAAPAVADVPKPQRAAKPKAPRKPKVEAAETVEIETVEIEVFEIEAPE
SEAAEGEIAETSAPEEVSAAAPAAVAPADNNTFYVTTAIAYPNGNPHIGHAYEAIATDAI
ARFARLDGKDVFFLTGTDEHGLKMVQTAQNEGLTPGELATRNAGRFRDMDERLNVSFDRF
IRTTEPAHHKSVQAIWNRMLENGDIYADTYAGWYSVRDEAYYAEDETVVGEDNVRRGPQG
TPVEWVEEKSYFFRLSAYQDRLLALYESQPDFIGPDARRNEIISFVKGGLKDLSISRTTF
DWGVRVPHDDEHVMYVWVDALTNYITGVGFPDENDANWKYWPADVHVIGKDIIRFHAVYW
PAFLMSAGVPVPKRVYAHGFLFNRGEKMSKSVGNVVDPFNLADQYGVDQLRYFFLREVPF
GQDGNYNHEAIVARINADLANDLGNLAQRSLSMIAKQLGGQLPEPGEFSANDRAILAEAD
AMIGAARKAMATQQIHQWLNAVWSVVAEANRYFAGEAPWALAKTDPKRQHTVLYVTAEVI
RQVAILTQPVMPTASAKLLDSLGIPEDERNFARLGGEIRIAAGTQLPAPQAVFPRYIEPT
AA
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
gtggccaaggccagcaagaccaccgtgaagaagggcaagcccgcgagcgccgcgaagaac
aaggctgccgccaagtcgcccgcaaaagccaagtcgcccgtgaaggccggcgccaagacc
aaggcgaaggacaaggacgccaaggacaaggccaccaaagcaaaggctgccaaaggcaag
gcggccaagacggcgccggccaaggccaagaccaaggccaagagcaaagccccgaaggcc
aaggcgaccaaagtcgtcgccaagaaagccgtgaaggcgcctgccaagaaggtcgtcgcc
aagccggccgcaactgcagccaagaagccggccgcaacgagcaaagccgcgcctgcgaag
aagcccgcggccagcagacagccggccgcgccgaaggcggctgcgccggccgttgcagac
gtgccgaagccgcagcgcgccgccaagccgaaagcgccgcgcaagccgaaggtcgaagct
gccgagaccgttgagatcgagaccgttgagattgaggtttttgagatcgaggcccctgag
agcgaggctgccgagggcgaaatcgctgagaccagcgcaccggaggaggtgagcgccgcg
gcgcccgccgcagtcgcgcccgcagacaacaacacgttctacgtcacgaccgcgatcgcc
tatccgaacggcaatccgcatatcggccacgcctatgaggcgatcgcgactgatgcgatc
gcgcgctttgcgcggctcgatggcaaggacgtgttcttcctgaccggcaccgacgagcac
ggcctgaagatggtgcagaccgcgcagaacgagggcctgacgccaggtgagctcgcgacc
cgcaatgccggccgcttccgcgacatggacgagcggctgaatgtctcgttcgaccgcttc
atccgcaccaccgagccggcacaccacaaatcggtgcaggcgatctggaatcgcatgctc
gagaacggcgacatctacgccgacacctatgccggctggtactcggtgcgcgacgaggcc
tattacgccgaggacgagacggtcgtcggcgaggacaatgtccgccgcggtccgcagggc
acgccggtcgaatgggtcgaggagaagagctacttcttccgcctgtcggcctatcaggac
aggctgctggcgctgtatgagagccagccggacttcatcggtccggatgcgcggcgcaac
gagatcatcagcttcgtcaagggcggtctgaaggacctgtcgatctcgcgcacgacgttc
gactggggcgtccgcgtgccccatgacgacgagcacgtgatgtatgtctgggtcgacgcg
ctgaccaactacatcaccggcgtcggcttccccgacgagaacgatgcgaactggaaatac
tggccggccgacgtccacgtcatcggcaaggacatcatccgctttcacgcggtgtactgg
ccggccttcctgatgtcggcgggcgtgcccgtgccgaagcgggtctatgcccacggcttc
ctgttcaacaggggcgagaagatgtcgaaatcggtcggcaatgtcgtcgatccgttcaat
ctcgccgaccagtatggcgtcgaccagctgcgctatttcttcctgcgcgaggtgccgttc
ggccaggacggcaactacaatcacgaggcgatcgtcgcgcgcatcaatgccgaccttgcc
aatgacctcggcaatctcgcgcagcgctcgctgtcgatgatcgcaaagcagctcggaggc
cagctgccggagcccggtgagttctcggccaacgacagagcgatcctggcggaggccgat
gcgatgatcggcgccgcgcggaaagccatggcgacgcagcagatccaccaatggctcaac
gccgtctggtcggtcgtggccgaggccaaccgctatttcgccggcgaggcgccgtgggcg
ttggccaagaccgatccgaagcgccagcacaccgtgctctacgtcaccgcggaggtgatc
cggcaggtcgcgatcctgacccagccggtgatgccgaccgcgtccgcaaagctgctcgac
agcctcggcatccccgaggatgagcgcaacttcgcgcggctcggcggcgagatccggatt
gccgccggcacgcagttgccggcaccacaggcggtgttcccgcgctacatcgagccgacg
gcggcgtga

DBGET integrated database retrieval system