KEGG   Bradyrhizobium sp. BTAi1: BBta_4483Help
Entry
BBta_4483         CDS       T00528                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
bbt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bbt01100  Metabolic pathways
bbt01110  Biosynthesis of secondary metabolites
bbt01130  Biosynthesis of antibiotics
bbt01230  Biosynthesis of amino acids
Module
bbt_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bbt00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BBta_4483 (trpC)
Enzymes [BR:bbt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BBta_4483 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ABQ36519
RhizoBase: BBta_4483
UniProt: A5EK25
Position
4695357..4696175
Genome map
AA seq 272 aa AA seqDB search
MSDILAKIEAYKREEIAAAKRACPLAELEARARDASPPRGFVAAIRNKHANGDYALIAEV
KKASPSKGLIRADFDPPVLARAYQAGGAACLSVLTDTPSFQGHLEFMVAARSATTLPVLR
KDFLFDTYQVAEARAHGADCILIIMAALDDAAAADIEAAALDSGMDVLIEIHDRDELDRA
LKLRSPMIGINNRNLRTFETTLATSEALAPLVPKERLLVGESGIFTPADLTRLARVDIQT
FLVGESLMRQADVTAATRALLARDASPASAAE
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgtcggatatcctggccaagatcgaagcctataagcgcgaggagatcgccgctgccaag
cgcgcctgtcccctcgcggagctcgaggcccgcgcgcgcgacgcttcgcctccccgcgga
tttgtggccgccatccgcaacaagcatgcgaacggcgactatgcgctgatcgcggaggtg
aagaaggcgtcgccgtcgaaggggctgatccgcgccgatttcgacccgcccgttctcgcc
agggcctatcaggccggcggcgccgcctgcctctctgtgctgaccgatacgccatccttc
caggggcatctggagttcatggtggcggcgcgatccgcgaccaccctgcccgtgttgcgc
aaggacttcttgttcgacacctaccaggtggccgaggcgcgtgcgcatggcgcagactgc
atcctgatcatcatggcggcgctggatgacgcagctgccgccgatatcgaggccgcggcg
ctcgacagcggcatggatgtgctgatcgaaatccatgatcgcgacgagctcgaccgcgcg
ctcaagctgcgctcgccgatgatcggcatcaacaaccgcaacctgcgcaccttcgagacc
acgctggcgacctccgaggcgctcgcgccgctggtgcccaaggagcgtctgctcgtcggc
gagagcggcatcttcaccccagccgatctcacccgtctggcgcgcgtcgacatccagacc
ttcctggtcggcgaaagcctgatgcgccaggctgacgtgaccgccgcgacgcgcgcgctg
ctggcgcgcgacgccagccccgcaagcgcggccgagtga

DBGET integrated database retrieval system