KEGG   Bradyrhizobium sp. BTAi1: BBta_5072Help
Entry
BBta_5072         CDS       T00528                                 

Gene name
tufB
Definition
(GenBank) translation elongation factor 1A (EF-1A/EF-Tu)
  KO
K02358  elongation factor Tu
Organism
bbt  Bradyrhizobium sp. BTAi1
Brite
KEGG Orthology (KO) [BR:bbt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bbt03012]
    BBta_5072 (tufB)
   03029 Mitochondrial biogenesis [BR:bbt03029]
    BBta_5072 (tufB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bbt04147]
    BBta_5072 (tufB)
Translation factors [BR:bbt03012]
 Eukaryotic Type
  Elongation factors
   BBta_5072 (tufB)
 Prokaryotic Type
   BBta_5072 (tufB)
Mitochondrial biogenesis [BR:bbt03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BBta_5072 (tufB)
Exosome [BR:bbt04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BBta_5072 (tufB)
  Exosomal proteins of breast cancer cells
   BBta_5072 (tufB)
  Exosomal proteins of colorectal cancer cells
   BBta_5072 (tufB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ABQ37073
RhizoBase: BBta_5072
UniProt: A5ELM9
Position
complement(5289532..5290722)
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERNKPHCNIGTIGHVDHGKTSLTAAITKILAETGGATFTAYDQIDKAPEEKARG
ITISTAHVEYETQNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPALVVFLNKCDMVDDPELLELVELEVRELLSKYEFPGDKIPIIKGSALAALE
DSDKKLGHDAILELMRNVDEYIPQPERPIDQPFLMPVEDVFSISGRGTVVTGRVERGVIK
VGEEIEIVGIRPTQKTTVTGVEMFRKLLDQGQAGDNIGALLRGTKREDVERGQVLCKPGS
VKPHTKFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGVVHLPEGTEMVMPGDNIA
MEVHLIVPIAMEEKLRFAIREGGRTVGAGVVASIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagctaaatttgaacgtaacaagccccactgcaacatcggcaccatcggtcac
gtcgaccatggcaagacgtcgctgacggctgccatcaccaagatcctggccgagaccggc
ggtgcgacgttcactgcctacgatcagatcgacaaggcgccggaagagaaggctcgcggc
atcaccatctcgaccgcccacgtcgagtacgagacgcagaaccgccactatgcgcacgtc
gactgccccggccacgccgactacgtgaagaacatgatcaccggcgccgcccagatggac
ggtgcgatcctggtcgtgtcggccgctgacggcccgatgccgcagacccgcgagcacatc
ctgctcgcccgccaggtcggcgttccggcgctggtcgtgttcctcaacaagtgcgacatg
gtcgacgatccggagctgctcgagctcgtcgagctcgaggtccgcgagctgctctcgaag
tacgaattcccgggcgacaagatcccgatcatcaagggctcggcgctggccgctcttgaa
gattccgacaagaagctcggccacgacgccatcctcgagctgatgcgcaatgtcgacgag
tacattccgcagccggagcgtccgatcgaccagcccttcctgatgccggtcgaagacgtg
ttctcgatctcgggccgcggcaccgtggtgaccggccgtgtcgagcgcggcgtcatcaag
gtcggtgaggaaatcgagatcgtcggtatccgtccgacccagaagaccaccgtcaccggc
gtcgaaatgttccgcaagctgctcgatcagggccaggctggcgacaacatcggtgcgctg
ctccgcggcaccaagcgcgaggacgtcgagcgcggtcaggtgctgtgcaagccgggttcg
gtcaagccgcacaccaagttcaaggctgaggcttacatcctcaccaaggaagagggcggc
cgtcacacgccgttcttcaccaactaccgtccgcagttctacttccgcacgaccgacgtg
accggcgtcgttcacctgccggaaggcaccgagatggtgatgccgggcgacaacatcgcg
atggaagtgcacttgatcgtgccgatcgcgatggaagagaagctgcgcttcgccatccgt
gaaggcggccgcaccgtcggcgccggcgtcgtcgcctcgatcatcgagtaa

DBGET integrated database retrieval system