KEGG   Bradyrhizobium sp. BTAi1: BBta_6224Help
Entry
BBta_6224         CDS       T00528                                 

Gene name
thiG
Definition
(GenBank) thiazole-phosphate synthase
  KO
K03149  thiazole synthase [EC:2.8.1.10]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
bbt00730  Thiamine metabolism
bbt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BBta_6224 (thiG)
Enzymes [BR:bbt01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.10  thiazole synthase
     BBta_6224 (thiG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ThiG His_biosynth
Motif
Other DBs
NCBI-ProteinID: ABQ38147
RhizoBase: BBta_6224
UniProt: A5EPQ3
Position
6471458..6472240
Genome map
AA seq 260 aa AA seqDB search
MPTFYDKTFTSRLLIGTALYPSPAIMQDAIRASGAEIVTVSLRREAAGGKSGDAFWKLIR
ELNVTVLPNTAGCRSVREAVTTAKLARELFGTSWIKLEVIADNDTLQPDVVGLVEAATIL
IKDGFEVFPYCTEDLSVATRLVDAGCKVVMPWAAPIGSAKGIINRDALKLLRDRLPDITL
VVDAGLGAPSHAAEALELGYDAVLLNTAVAKAADPVAMARAFRLGCDAGRTAYEAGLMDA
RDFASPSTPVVGTPFWHAVS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccttctacgacaagaccttcacctcccgcctgctgatcggcaccgcgctctac
ccgtcgccggccatcatgcaggacgcgatccgcgcctccggggccgagatcgtcacggtg
tcgctgcgccgtgaggccgccggcggcaaatcgggcgatgcgttctggaagctgatccgc
gagctcaacgtcacggtgctaccgaacaccgccggctgccgcagcgtccgcgaggccgtc
accaccgccaagctcgcgcgcgaattgttcggcacgtcgtggatcaagctcgaagtcatc
gccgacaacgacaccctgcagccggacgtcgtcggcctggtggaggcggcgacgatcctg
atcaaggacggcttcgaggtcttcccttattgcaccgaggatctctcggtcgcgacgcgg
ctggtcgatgccggctgcaaggtcgtgatgccgtgggcggcaccgatcggcagcgcgaaa
ggcatcatcaatcgcgatgcgctgaagctgctgcgcgaccgcctgcccgacatcacgctc
gtcgtcgacgccggcctcggcgctccctctcacgcggccgaagcgctcgagctcggctat
gacgcggtgctgctcaacactgcggtggccaaggctgccgacccggtggcgatggcccgc
gccttcaggctcggctgtgatgccggccgtaccgcctacgaggccgggctgatggacgcc
cgcgacttcgcctcgccctccacccctgtcgttgggacaccgttctggcatgccgtatcc
tga

DBGET integrated database retrieval system