KEGG   Bradyrhizobium sp. BTAi1: BBta_6426Help
Entry
BBta_6426         CDS       T00528                                 

Gene name
cycA
Definition
(GenBank) cytochrome c2
  KO
K08738  cytochrome c
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
bbt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bbt00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BBta_6426 (cycA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ABQ38336
RhizoBase: BBta_6426
UniProt: A5EQ92
Position
complement(6694745..6695179)
Genome map
AA seq 144 aa AA seqDB search
MLRAGVVAMALTVTSAGAGFALDGGDPAKGEQIFKQCMTCHRIGPDAKNAVGPVLTGVVG
RATGTYPGFAYSDLNKHAGEAGLVWTEDNIFEYLPDPSAFLKKYLTEKGKADQAAGSTKM
VFKLANEQQRKDVIAYLKTFSEKK
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgctcagagcgggtgtggttgcgatggctcttacggtaacatctgctggtgccggcttt
gcgctcgacggcggtgacccggcgaaaggcgaacagatcttcaaacaatgcatgacctgc
catcgcatcggacccgacgcgaagaacgctgtcggcccggtgctgaccggcgtcgtcggg
cgcgccaccgggacgtatccaggctttgcctattcggacctcaacaagcacgctggcgag
gccggcctggtctggaccgaggacaatatcttcgagtacctccccgaccccagcgccttt
ctcaagaagtatctgaccgagaagggcaaggcggaccaggccgccggctccaccaagatg
gtgttcaagctcgccaacgagcagcagcgcaaggacgtcatcgcctatctgaagacgttc
tccgagaagaagtga

DBGET integrated database retrieval system