KEGG   Bradyrhizobium sp. BTAi1: BBta_6928Help
Entry
BBta_6928         CDS       T00528                                 

Gene name
cbbA
Definition
(GenBank) fructose-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
bbt00010  Glycolysis / Gluconeogenesis
bbt00030  Pentose phosphate pathway
bbt00051  Fructose and mannose metabolism
bbt00680  Methane metabolism
bbt00710  Carbon fixation in photosynthetic organisms
bbt01100  Metabolic pathways
bbt01110  Biosynthesis of secondary metabolites
bbt01120  Microbial metabolism in diverse environments
bbt01130  Biosynthesis of antibiotics
bbt01200  Carbon metabolism
bbt01230  Biosynthesis of amino acids
Module
bbt_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bbt_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
bbt_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bbt_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bbt_M00612  Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:bbt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBta_6928 (cbbA)
   00030 Pentose phosphate pathway
    BBta_6928 (cbbA)
   00051 Fructose and mannose metabolism
    BBta_6928 (cbbA)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BBta_6928 (cbbA)
   00680 Methane metabolism
    BBta_6928 (cbbA)
Enzymes [BR:bbt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     BBta_6928 (cbbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase CoA_binding_3
Motif
Other DBs
NCBI-ProteinID: ABQ38815
RhizoBase: BBta_6928
UniProt: A5ERM1
Position
7257266..7258333
Genome map
AA seq 355 aa AA seqDB search
MARITLRQLLDHAAEHDYGVPAFNINNMEQALAIMEAANAADAPVIIQASRGARAYANDV
MLKHMMDALTEIYPQIPICVHLDHGNEPATCMTAIQSGFTSVMMDGSLKADGKTPGDWDY
NVGVTKTVTTMAHLGGISVEGELGVLGSLETGMGDKEDGHGAEGKLSHDQLLTNPDEAVK
FVRETKVDALAIAMGTSHGAYKFTRKPDGDILAMNVIEEIHRKLPNTHLVMHGSSSVPQD
LQEIINSYGGKMKPTWGVPVAEIQRGIKNGVRKINIDTDNRMAMTGQIRKILSEHPEEFD
PRKYLKPAMEAMTKLCKQRFEEFNTAGQAGKIKRVLTTAEMAKRYAKGELDPTVA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtattacgttgcgtcaattgctcgatcacgcggcggagcacgattacggcgtc
ccggccttcaacatcaacaatatggagcaggcgctggcgatcatggaggcggccaatgcg
gccgatgccccggtcatcatccaggcctcgcgcggcgcccgcgcctatgccaacgacgtc
atgctcaagcacatgatggacgcgctgaccgagatctatccgcagatcccgatctgcgtg
catctcgatcacggcaacgagccggcgacctgcatgaccgcgatccagtccggcttcacc
tcggtcatgatggacggctcgctcaaggccgacggcaagacgcccggcgattgggactac
aatgtcggcgtcaccaagacggtgaccaccatggcgcatctcggcggcatctcggtcgag
ggtgagctcggcgtcctcggctcgctcgagaccggcatgggcgacaaggaggatggccac
ggcgcggaaggcaagctgtcgcatgatcagctgctgaccaatcccgacgaggcggtgaag
ttcgtgcgcgagaccaaggtcgacgcgctcgcgatcgcgatgggcacatcgcacggcgcc
tacaagttcacgcgcaagccggacggcgacattctcgcgatgaacgtgatcgaggagatc
caccgcaaactgccgaacacgcatctggtgatgcacggctcgtcgtcggtgccgcaggac
ctgcaggagatcatcaattcctatggcggcaagatgaagccgacctggggcgtgccggtc
gccgagatccagcgcggcatcaagaacggcgtgcgcaagatcaacatcgatactgacaac
cgcatggcgatgaccggccagatccgcaagatcctgtcggagcacccggaagagttcgat
ccgcgcaaatacctgaagccggcgatggaagcgatgaccaagctgtgcaagcagcgcttc
gaggagttcaacaccgccggccaggccggcaagatcaagcgcgtgctgacgaccgcggag
atggccaagcgctacgccaagggcgagctcgacccgacggtggcttaa

DBGET integrated database retrieval system