KEGG   Bradyrhizobium sp. BTAi1: BBta_7443
Entry
BBta_7443         CDS       T00528                                 
Name
(GenBank) putative conjugal transfer protein trbE
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
bbt02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bbt00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BBta_7443
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bbt02044]
    BBta_7443
Enzymes [BR:bbt01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     BBta_7443
Secretion system [BR:bbt02044]
 Type IV secretion system
  Trb secretion system protein
   BBta_7443
SSDB
Motif
Pfam: P-loop_TraG CagE_TrbE_VirB AAA_22 AAA_10 TraG-D_C ABC_tran HerA_C AAA_29 FtsK_SpoIIIE TrwB_AAD_bind AAA_16 AAA_23 DUF87 P22_CoatProtein
Other DBs
NCBI-ProteinID: ABQ39302
RhizoBase: BBta_7443
UniProt: A5ET08
Position
7817208..7819637
AA seq 809 aa
MNLAEYRRHNQSLADFLPWAALVAKGVVLNKDGSFQRTARFRGPDLDSSTPAELVAITSR
LNNALRRLGSGWAVFIEAQRVPAHRYPSTQFPDPVSALVDAERRAQFEEEGAHFESGYFL
TLLWLPPADDAARAEAWLYENRAQGAADWRATLEGFVDRTDRVLALLEGFMPESDWLDDA
ETLTYLHSCISTRRQRVRVPETPMYLDAILVDEDLTGGLEPRLGRAHLRTLTIMGFPSQT
WPGLLDDLNRLAFSYRWATRAICLDKTDAAKLLGKIRRQWFAKRKSIMAILKEVMTNEAS
VLMDSDAANKALDADAALQELGTDLVGEAYVTATVTVWDDDPRIADERLRLVEKAIQGRD
FTCMREGVNAIEAWLGSLPGHVYANVRQPPISTLNLAHMMPFSAVWAGPERDEHFQAPPL
LFAKTEGSTPFRLSLHVGDVGHTLIVGPTGAGKSVLLALMALQFRRYAGAQVFAFDFGGS
IRAAALAMGGDWHDLGGALSDSAAEPVALQPLARVDDPGERAWAAEWVAALLGRESVTVT
PELKEHLWSALTSLASAPIQERTITGLSVLLQSNALKQAIQPYTVAGPWGRLLDAETERL
GEAEVQAFETEGLIGAGAAPAVLSYLFHRIEDRFDGRPTLLIVDEGWLALDDPGFAGQLR
EWLKTLRKKNASVIFATQSLADIDGSAIAPAIIESCPTRILLPNERALEPQIAAIYQRFG
LNDRQIEILSRATPKREYYCQSRRGNRLFELGLSEVALAFTAASAKSDQTAIEELLAEHG
RGGFTAAWLRRKDLDWAADMLTHNQETTS
NT seq 2430 nt   +upstreamnt  +downstreamnt
atgaaccttgccgagtatcgtcgccataaccagagcctcgccgacttcctgccgtgggcg
gcgctcgtcgccaagggcgttgttctcaacaaggatggctccttccagcgcaccgcacgc
tttcgcggtccagacttggattcttccacgcccgccgagttggtggccatcacgtcgcgt
ctcaataatgcgttgcgtcgccttggctccggctgggccgtgttcattgaggcccagcgc
gtgccggcgcacaggtatccgtcaactcaatttccggatcccgtttcggcgctggtcgat
gccgaacgtcgagcccaattcgaagaagaaggcgcgcatttcgagagcggctacttcctg
acactgctctggctgccgcccgccgatgacgcggcccgcgcggaagcttggctctatgag
aaccgcgcccagggcgccgccgactggcgtgccacgctcgaaggtttcgtcgaccgcacc
gatcgcgtgctcgcgctgctcgaaggcttcatgccggaatcggattggctcgatgacgcc
gagaccctgacctacctgcattcctgcatctcgacgcggcgccagcgcgtgcgcgtgccg
gaaacgccgatgtacctcgacgccatcctggtggacgaggacctgacgggtggcctcgaa
ccacggctcggccgcgcacatctgcgcacgctcaccatcatgggctttccatcacagact
tggccgggcctgctcgacgacctcaatcgcctggcgttttcctatcgctgggcgacacgc
gccatctgcctcgacaagaccgacgcggccaagctcctcggcaagatccgccgtcagtgg
ttcgccaagcgcaagagcatcatggcgatcctcaaggaggtgatgaccaacgaggcgtcg
gtgctgatggactccgacgccgccaacaaggcgctcgatgccgacgccgctctgcaagaa
cttggcaccgacctcgtcggcgaggcctacgtcaccgccactgttaccgtctgggacgat
gatccgcggatcgcggacgagcgccttcgcctggtcgagaaggccattcagggccgcgac
ttcacctgcatgcgcgaaggcgtcaacgcgatcgaagcctggcttgggtctctcccaggg
catgtctacgccaatgtccggcagccgccgatctccacgctcaacctcgcgcatatgatg
ccgttttcggcggtttgggccgggcctgaacgggacgagcacttccaggcgccgccgctt
ctcttcgccaagaccgagggatcgaccccgttccgcctcagcctccatgtcggggatgtc
ggccacaccttgatcgtcggcccgacgggcgccggcaagagtgtgctgctcgcgttgatg
gccttgcagttccggcgctatgccggtgcacaggtcttcgccttcgacttcggcggcagc
atccgggcggcggcgctcgcgatgggcggcgattggcacgatctcggcggagcgctctcc
gacagcgccgccgagcccgtcgcgctccaaccgctcgcgcgggtcgatgatcccggagag
cgcgcgtgggccgccgaatgggtcgcggcgctcctcggtcgcgagtccgtcaccgtcact
ccggaactgaaggaacacctatggtcagcgctgacttcgcttgcgtccgcgcctatccag
gagcgcaccatcaccgggctctcggtgctcctgcaatcaaatgccctgaaacaggcgatc
cagccctacaccgtggcaggcccctggggacgactgctcgacgccgagacggagcggctc
ggcgaggccgaagtccaggctttcgaaacggaagggttgatcggcgcgggcgcggctcca
gccgtcctatcctatctcttccatcgcatcgaagatcgcttcgacggccgacccaccttg
ctcatcgtcgacgaaggttggctcgccctcgacgatcccggcttcgccgggcaactgaga
gagtggctgaagacgcttcggaaaaaaaatgccagcgtcatctttgccacgcagtcgctt
gccgacatcgacggcagtgcgatcgcaccagccatcatcgagagctgcccgacccgcatc
ctgcttcccaacgagcgcgcgctcgagccgcagatcgcggcgatctaccagcgcttcggt
ctcaacgatcgccaaattgagattctgagccgcgcgacgccgaagcgcgaatattactgc
cagtcgcgacgcggcaatcgcctattcgaactcgggctgtccgaagtcgcgctcgccttc
accgccgcctcggcgaaatccgatcagaccgccatcgaagagctgctcgcggaacacggc
cgcggcggcttcaccgccgcctggctgcgccgaaaggatctcgactgggcagcggacatg
ctcacccacaaccaggagaccacgtcatga

DBGET integrated database retrieval system