KEGG   Bradyrhizobium sp. BTAi1: BBta_7448
Entry
BBta_7448         CDS       T00528                                 
Name
(GenBank) putative conjugal transfer protein trbG
  KO
K20532  type IV secretion system protein TrbG
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
bbt02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bbt00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BBta_7448
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bbt02044]
    BBta_7448
Secretion system [BR:bbt02044]
 Type IV secretion system
  Trb secretion system protein
   BBta_7448
SSDB
Motif
Pfam: CagX
Other DBs
NCBI-ProteinID: ABQ39307
RhizoBase: BBta_7448
UniProt: A5ET13
Position
7822646..7823632
AA seq 328 aa
MRPLAISSLLLASVSLGACATAWKPPQISYDNTPKPAVLQAEPPKPIQIVEVPKPLPLPG
QLKPLPGNTKRAPEPADPHARVDQANGAARVQPTRAGYLNAIQVYPFSDGALYQVYAAPG
QITDIALEPGEQLTGSGPVAAGDTVRWIIGDTESGAGPAKRVHILVKPTRADLITNLVIN
TDRRTYHLELHSDDKTYMASVSWAYAQDQLIALRQQNAAAEAAAPVATGVDINALNFRYR
IEGDTPPWRPLRAFDDGRQVFIEFPTGISQGELPPLWVIGAEGDGQLVNYRVRGNHMIVD
RLFAAAELKLGGKHQELVRIVRTDGRPR
NT seq 987 nt   +upstreamnt  +downstreamnt
atgcgcccgcttgcgatctcgtcgctcttacttgcgtctgtctccctcggcgcctgcgcc
acagcctggaaaccgccgcagatcagctacgacaacacgccgaagcccgcggtgctgcag
gccgagccgcccaagcccattcagatcgtcgaggtgccgaagccgttgccgctgcccgga
caactcaagccgctgcccgggaacacgaagcgcgcccccgaacctgcggatccgcatgct
cgcgtcgatcaggccaatggcgcggcccgcgtccagccgacacgggcaggctatctcaac
gctatccaggtctaccccttttccgatggcgcgctgtatcaggtctatgccgcgccgggc
caaatcaccgacatcgcgctcgagccgggcgagcagttgacgggctcagggcctgtcgct
gccggagataccgtgcggtggatcatcggcgacaccgagagcggcgccgggccagccaaa
cgtgtccacatcctggtgaagcccacccgtgcggatctcatcaccaaccttgtcatcaat
acagaccgccggacctatcacctcgagctgcattccgacgacaagacgtatatggcgtcg
gtctcttgggcttatgcgcaggatcagctcatcgcgctgcgccagcagaatgcggccgcc
gaggccgctgcccccgtcgcaaccggcgtcgacatcaatgcactgaacttccgctatcgc
atcgagggcgatactccgccgtggcggccgctgcgcgccttcgatgacggccggcaggtg
ttcatcgaattcccgaccgggatctcacagggtgagctgccaccgctctgggtgatcggc
gcggaaggcgacggccagctcgtcaactaccgtgtccgcggcaatcacatgatcgtcgac
cgcctgttcgctgcggcggagctgaagctcggcggcaagcaccaggagctggtgcgcatc
gtccgcaccgatgggaggccgcggtga

DBGET integrated database retrieval system