KEGG   Bradyrhizobium sp. BTAi1: BBta_7743
Entry
BBta_7743         CDS       T00528                                 

Definition
(GenBank) Conjugal transfer protein TrbD
  KO
K20529  type IV secretion system protein TrbD
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
bbt02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bbt00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BBta_7743
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bbt02044]
    BBta_7743
Secretion system [BR:bbt02044]
 Type IV secretion system
  Trb secretion system protein
   BBta_7743
SSDB
Motif
Pfam: VirB3 HHV-5_US34A
Other DBs
NCBI-ProteinID: ABQ39584
RhizoBase: BBta_7743
UniProt: A5ETU0
Position
8134254..8134754
AA seq 166 aa
MGAAASADPAIDRRPGGQGHRGDHHHRHWPDARLRRYERRLPQARADRLWPVDRIRSQLL
LPELLQLRRWGGGVMAGVLETAEVPGFSVPVHRALTEPILLGGAPRSIAILNGTLAAALG
LGLRLWLVGLGLWAVGHFAAVWAAKRDPMFVEVTRRHLRIPGFLGV
NT seq 501 nt   +upstreamnt  +downstreamnt
gtgggagcagccgcttcagcagatcctgcaatcgatcgaaggcccggtggccaaggtcat
cgcggtgatcatcatcatcgtcactggcctgacgctcgccttcggcgatacgagcggcgg
cttccgcaggctcgtgcagatcgtctttggcctgtcgatcgcattcgcagccagctcctt
cttcctgagcttcttcaacttcggcggtggggcggtggtgtgatggctggtgtgcttgag
accgccgaggtccccggcttctcggtgccagtccatcgggcgctgaccgagcccatcctc
ctcggcggcgcgccgcgctcgatcgccatcctcaacggcacgctcgccgccgcgctcggg
ctcggcctgcggctctggctcgtcggcctcggcctttgggccgtcggccatttcgcggcg
gtgtgggcggcgaagcgcgatccgatgttcgtggaggtcacgcgccggcacctgcgcatt
cccggcttcctgggcgtgtga

DBGET integrated database retrieval system