KEGG   Bradyrhizobium sp. BTAi1: BBta_7744
Entry
BBta_7744         CDS       T00528                                 
Symbol
trbE
Name
(GenBank) conjugal transfer protein trbE
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
bbt02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bbt00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BBta_7744 (trbE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bbt02044]
    BBta_7744 (trbE)
Enzymes [BR:bbt01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     BBta_7744 (trbE)
Secretion system [BR:bbt02044]
 Type IV secretion system
  Trb secretion system protein
   BBta_7744 (trbE)
SSDB
Motif
Pfam: P-loop_TraG CagE_TrbE_VirB AAA_22 AAA_10 AAA_29 FtsK_SpoIIIE ABC_tran AAA_16 TraG-D_C DO-GTPase2
Other DBs
NCBI-ProteinID: ABQ39585
RhizoBase: BBta_7744
UniProt: A5ETU1
Position
8134763..8137201
AA seq 812 aa
MMNLAEYRRTSSRLADFLPWAALAAEGVVLNKDGSFQRTARFRGPDLDSSVPAELVAVAG
RLNNAFRRLGSGWAIFVEAQRHGVGAYPSSRFPDAASALVDAERKADFEEASAHFESSYF
LTFTYLPPAEDAARAENWLYEGKADRGVDPHEILSGFVDRTDRVLQLIEAFMPECAWLDD
GETLTYLHSCISTRRHRVRVPETPIYLDALLADQPLTGGLEPRLGDAHLRVLTIVSFPTA
TTPGILDELNRLAFPYRWATRAILLDKTDATRLLTKIRRQWFAKRKSIAAILKEVMTNEA
SALVDTDAANKAADADLALQELGADYAGEAYVTATVTVWDDDPRIAAEKLRLVEKAIQGR
DFTAMPETINAVDAWLGSLPGHVYANVRQPPISTLNLAHMIPLSAVWAGPERDEHFGAPT
LLFGKTEGSTPFRFSLHVGDVGHTLVVGPTGAGKSVLLALMALQFRRYSRSQVFAFDFGG
SIRAAALAMGGDWHDLGGGLTDGSAESVSLQPLAGIHHVPERAWAADWIVAILMREGVAI
TPEVKEHLWTALTSLASAPVVERTITGLAVLLQSNDLKQALRPFCVGGAYGRLLDAEHEH
LGEASVQAFETEGLIGTGAAPAVLAYLFHRIEDRLDGRPTLLIVDEGWLALDDEGFAGQL
REWLKTLRKKNASVVFATQSLSDIDNSPIAPAIIESCPTRVLLPNERAIEPQITAIYRRF
GLNDRQIEILARAMPKRDYYCQSRRGNRLFELGLSDVALALCAASSKADQAAIERIVAEH
GRENFLPAWLHLRGVAWAADLIPNLTNLETQS
NT seq 2439 nt   +upstreamnt  +downstreamnt
atgatgaacctcgccgaatatcgccgcacgtcttcgcgcctcgccgacttcctgccgtgg
gcagcgctcgccgcagagggcgtcgtcctcaacaaggacggcagcttccagcgcacggca
cgcttccgcggccccgacctcgactcctccgtgccggccgagctggtcgccgtcgcgggc
cgcctcaacaacgccttccggcgcctcggctccggctgggcgatcttcgtcgaggcgcag
cgtcacggcgtcggcgcctatccgtcgagccgctttcccgatgccgcgtctgcgctggtc
gacgccgagcgcaaggcggacttcgaggaagcgagtgcgcatttcgagtcgagctacttc
ctcaccttcacctacctgccgccggccgaggacgccgcgcgcgccgagaactggctctac
gagggcaaggccgaccgcggcgtcgatccgcacgagatcctaagcggcttcgtcgaccgc
acggatcgcgtcctgcagctcatcgaagccttcatgcccgaatgcgcctggctcgatgac
ggcgagacgctgacctacctgcattcctgcatctcgaccaggcgccatcgcgtgcgcgtg
cccgagacgccgatatatctcgacgcgttattggccgaccagccgctgacgggaggcctc
gagccgcggctcggcgacgcacaccttcgcgtgctcacgatcgtcagttttccgacggca
accacgccgggcattttggatgagctgaaccggctggcgtttccttatcgctgggcgacg
cgcgcgatcctgctcgacaagaccgacgcaaccaggctgctgaccaagatccgccggcaa
tggttcgccaagcgcaagagcatcgcggcgatcctgaaggaggtaatgaccaacgaggcc
tcggctctcgtcgacaccgatgccgcgaacaaggcggccgacgccgacctcgcgctccag
gagctcggcgccgactacgccggcgaggcctatgtcaccgcgacggtgacggtctgggac
gatgacccccgcatcgccgccgaaaagctgcggctggtcgagaaggccatccagggccgc
gacttcaccgcgatgcccgagacgatcaatgccgtggacgcctggctcggctcgctgccg
gggcatgtctacgccaacgtgcgccagccgccgatctcgaccctcaacctcgcccacatg
atcccgctgtcggcggtgtgggcggggccggaacgggatgagcacttcggtgcacccacc
ttgctgttcggcaagaccgaagggtccaccccgttccggttctctttgcatgttggtgac
gtcggtcacacgctcgtcgtcggcccgaccggcgccggcaagtcggtgctgctggcgctg
atggcccttcagttccggcgctattcccgctcgcaggtcttcgccttcgactttggcggt
tcgatccgcgccgccgcgctcgccatgggcggcgactggcacgacctcggcggcggtctc
acggacgggtccgccgagagcgtttcgctgcagccgctcgccggcatccaccatgtcccc
gaacgcgcctgggccgccgactggatcgtcgcgatcctgatgcgcgagggcgtggcgatc
acacccgaggtcaaggagcatctctggaccgcgctgacctctcttgccagcgctcccgtc
gtcgaacgcacgatcaccggcctcgcggtgctcctgcaatcaaacgatctcaagcaggcg
ctgcggcccttttgtgtcggcggggcctatggccgcctgctcgacgccgagcacgagcat
ctcggcgaggcatcggtccaggccttcgagaccgagggcctgatcggcaccggcgcggcg
ccggccgtgctcgcctatctgtttcaccgcatcgaggatcgcctcgacgggcggccgacc
ttgctgatcgtcgacgaaggctggctggcgctcgacgacgaaggcttcgcgggccagctc
cgggagtggctgaagacgctccgaaagaagaacgccagcgtcgtcttcgccacgcagtcg
ctttccgacatcgacaattcaccgatcgcgccggccatcatcgagagctgcccgacgcga
gtgctgctcccgaacgagcgggcgatcgagccgcagatcactgcgatctaccgcaggttc
gggttaaacgatcgccagatcgaaatcctcgcgcgcgcgatgccgaagcgcgactactac
tgccagtcgcgacgcggcaacaggctcttcgaactcggcctctccgacgtcgctctcgcc
ctgtgcgccgcgtcctccaaggccgatcaagccgccatcgagcgcatcgtcgccgaacat
ggccgtgagaatttcctgccggcatggctgcacctgcgcggcgtcgcgtgggccgccgat
ctcatcccaaacctcaccaacctggagacacaatcatga

DBGET integrated database retrieval system