KEGG   Bradyrhizobium sp. BTAi1: BBta_7745Help
Entry
BBta_7745         CDS       T00528                                 

Definition
(GenBank) putative conjugal transfer protein trbJ
  KO
K20266  type IV secretion system protein TrbJ
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
bbt02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bbt00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BBta_7745
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bbt02044]
    BBta_7745
Secretion system [BR:bbt02044]
 Type IV secretion system
  Trb secretion system protein
   BBta_7745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4141 LXG Mod_r Pox_F11 DNA_pol3_delt_C DUF948
Motif
Other DBs
NCBI-ProteinID: ABQ39586
RhizoBase: BBta_7745
UniProt: A5ETU2
Position
8137198..8137962
Genome map
AA seq 254 aa AA seqDB search
MIVRRSRAALLAATALSLPLWFSPVLVAPAAAQWIVYDPTNYAQNVLQAARALQQINNQI
TSLQNEAQMLINQARNLASLPYSSLQRLHQSVQRTQQLLGQAQNIAFDVQQVDRAFQTTY
GNASLSASDQQLIADARTRWQNTVGGLQDAMRVQAGVVGNIDTNRTEMSALVGQSQGATG
ALQATQAGNQILALQAQQLADLTAVVAADGRARALADAERAAAAEQGREQRRRFLTPGAG
YQAGNARMFPNSGK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgattgtccgtcgttcccgcgcggcgcttcttgccgcgacggctctttcacttccgctt
tggttttcgccggtcctggtcgcgcctgccgcagcccagtggatcgtctacgacccgacc
aactatgcgcagaacgtgctgcaggcggcgcgcgcgctgcagcagatcaacaaccagatc
acctcgctccagaacgaagcgcagatgctaatcaaccaggcgcgcaatctcgcgagcttg
ccgtattcctcgttgcagcgtctccatcagtccgtccagcgcacccagcagcttctcggc
caggcgcagaacatcgccttcgacgtgcagcaggtcgaccgcgcgttccagaccacttat
ggcaacgcgtcactctcggcatcggatcagcaattgatcgcggatgcgcgcacgcgctgg
cagaatacggtcggcggacttcaggacgcgatgcgcgtccaggccggtgtggtcggcaac
atcgacacaaaccgcacggagatgtcggcgctggtcggccagagccaaggcgccacgggc
gcgctgcaagcaacacaggctggcaaccagatcctcgcactccaagcgcaacaactcgcc
gacttgactgctgtcgtggcagccgatgggcgagcacgggctctcgccgatgccgagcgc
gcggccgcggccgagcaaggacgtgaacagcgccggcgcttcctgacgcccggcgccggt
tatcaggccggaaacgcccgcatgttcccgaatagcggcaaatga

DBGET integrated database retrieval system