KEGG   Bradyrhizobium sp. BTAi1: BBta_p0256
Entry
BBta_p0256        CDS       T00528                                 
Symbol
avhB3
Name
(GenBank) Type IV secretory pathway AvhB3 protein
  KO
K03198  type IV secretion system protein VirB3
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
bbt03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bbt00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BBta_p0256 (avhB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bbt02044]
    BBta_p0256 (avhB3)
Secretion system [BR:bbt02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   BBta_p0256 (avhB3)
SSDB
Motif
Pfam: VirB3
Other DBs
NCBI-ProteinID: ABQ39894
RhizoBase: BBta_p0256
UniProt: A5EUQ0
Position
pBBta01:complement(189360..189698)
AA seq 112 aa
MIEAARLTEDTLFLACTRPAMIAGVTMEAMALNVMFSCILFLVAGSIIYGLVAIPIHGLC
RIICRHDPNMFRILLAWIETRGRTRNASFWGGSSCTPLKLVRRYQARDLGYA
NT seq 339 nt   +upstreamnt  +downstreamnt
atgatcgaggccgcgcgtctcacagaggacaccttattcctcgcctgcacacggccggcc
atgattgccggcgtcaccatggaagccatggcgctcaacgtgatgttttcctgcatccta
ttcctggtggccggaagcatcatctacggcctggtcgcgattccgatccatggtctttgc
cgcatcatctgccggcacgaccccaacatgttccggattctcctcgcctggatcgagacc
cgcgggcgcacgcgcaacgcgtccttctggggcggatcatcctgcacgcccctcaagctc
gttcggcgatatcaggcacgagaccttggctatgcgtaa

DBGET integrated database retrieval system