KEGG   Borreliella burgdorferi B31: BB_0842Help
Entry
BB_0842           CDS       T00012                                 

Gene name
argF
Definition
(RefSeq) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
bbu  Borreliella burgdorferi B31
Pathway
bbu00220  Arginine biosynthesis
bbu01100  Metabolic pathways
bbu01110  Biosynthesis of secondary metabolites
bbu01130  Biosynthesis of antibiotics
bbu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bbu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    BB_0842 (argF)
Enzymes [BR:bbu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     BB_0842 (argF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-GeneID: 1195700
NCBI-ProteinID: NP_212976
UniProt: O51782
Position
900799..901782
Genome map
AA seq 327 aa AA seqDB search
MYNLRNRSFLNLLDFTSKDIKYLLDLSINLKKSKYAGIEVQKLKGKNIVIIFEKDSTRTR
CAFEIAAYDQGANITYLGSKGNQMGSKESMIDTARVLGRMYDAIGFRGFSQQTVECLANY
SNVPVYNGLTDISHPTQILADLMTIKEHKGSLKGIKIVFCGDGRGNVANSLLKGCAIMGL
DFRIFAPKELFPDPDLTLKARSLALESGGKITITDSKEEAVKCADVVYTDVWVSMGESNW
EDRINLLKAYQVNKEIMCMAKDDAIFMHCLPAFHDLNTVIGKDIFDKYGLDGIEVTEEIF
ESKNSVVFDVAENRVHTIKAIMVSTLG
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtataatttacgaaataggagctttttaaatcttttagattttacaagcaaagatatt
aaatatttacttgatttatcgattaatttaaaaaagtcaaaatatgcaggaattgaagtg
caaaaacttaaaggtaaaaatatagttataattttcgagaaagattcaacaaggacccgg
tgtgcttttgagatcgcagcctatgatcaaggggcaaatattacttatttgggatctaag
ggtaatcaaatgggctcaaaagagtctatgatagataccgctagagttttgggacgcatg
tatgatgctattggatttagaggcttttctcaacagactgttgaatgtttggcgaattat
tctaatgttcctgtttacaatggattgacagatatttctcacccaacccaaatactagcc
gatttaatgacaataaaagaacataaggggagtttgaaagggattaaaatagtgttttgt
ggcgatggtagggggaatgttgctaattctttattgaaaggctgtgctattatggggctt
gattttagaatttttgctcccaaagagctttttccagaccccgatttgacgcttaaggct
aggtctttagccctagagagtgggggtaaaattacaattacagattctaaagaagaggct
gttaaatgtgctgatgttgtgtatacagacgtgtgggtatctatgggggagagtaattgg
gaagatagaataaatcttctaaaggcttatcaggttaataaagagataatgtgcatggca
aaagatgatgcaatatttatgcattgcttgcctgcttttcatgacttaaacactgtgatt
ggtaaggatatttttgataaatacggacttgatggaattgaagttacagaagaaattttt
gaaagtaaaaattcagttgtttttgatgtggctgaaaatagggtgcataccattaaagct
attatggtatcaactttgggataa

DBGET integrated database retrieval system